SecReT6
Protein ID: 407712939
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01746
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1375290..1376882 [+]
Producttype VI secretion system protein VasJ
NoteTssA
UniProt IDK0DKQ0
KEGG IDbpx:BUPH_01746
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.20E-20, Aligned region: 68..125
ImpA-rel_N [PF06812], Evalue: 4.20E-20, Aligned region: 402..414
Protein Sequence: 530 a.a.     [Download]
>gi|407712939|ref|YP_006833504.1| type VI secretion system protein VasJ [Burkholderia phenoliruptrix BR3459a]
MMLAGLFEKLFPARDDGEELARSRLDAWSAWLQPLAGDAGVGRDPGYEDTFFQLREETQKLSGIDDGLII
RSCEQLLMETGKDLRLAGYYALARLRQDGPAGFADGLELAAALVDRFGEAALPARVEAKKAALEMLATTR
MIELLETRGDFASADLERALAALDVLVAHTGSWPEAARPNLQPLVSRFERNDEATAGAHHHAVLPTSSSS
SSRAPASGSITSTRDLLDQARAMATWLRDQENGYLPSVRLVRSVRWDTLHEVPPTDATGRTRLAPPRMEL
RQQLKRLVLQKQWHELLERIEGAFMEGVNHLWLDLQYFQHVALDSVGAPYSTWRDMLRADFALFLERLPG
IERLAFNDGTPFADDVTLEWIARHAVVRDLEAGELLASLPVSADSEDGAIGDWPEIELQARELAGRDGIE
AAFAWLEALPGMKTDRHRYLQRLVMARVADHAGRADTALALLAELDAGTRSLPLARWEPALVFEIKQQLV
RALKTMSNRKDADKPGLARRIGELQAELTVLDPARSLTLS
 
Nucleotide Sequence: 1593 bp     [Download]
>gi|407711772|ref|NC_018695.1|:1375290-1376882 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGATGCTGGCAGGACTGTTTGAGAAACTCTTTCCGGCACGGGACGACGGCGAGGAGCTGGCCCGCTCGC
GCCTCGACGCGTGGAGTGCCTGGCTTCAGCCGCTCGCGGGCGACGCCGGTGTGGGCCGCGATCCCGGATA
TGAAGACACGTTTTTCCAGCTCCGGGAAGAAACGCAAAAACTCTCCGGAATCGACGATGGACTCATCATC
CGCTCGTGCGAGCAACTGCTCATGGAGACCGGCAAGGACTTGCGTCTGGCCGGCTACTATGCACTCGCAC
GGCTGCGGCAGGATGGCCCCGCAGGTTTCGCGGATGGCCTCGAGTTGGCGGCAGCGCTCGTCGACCGGTT
CGGCGAAGCCGCGCTGCCCGCACGCGTCGAAGCGAAAAAGGCGGCACTCGAGATGCTGGCCACCACCCGC
ATGATCGAGTTGCTGGAAACCCGCGGCGACTTCGCGTCAGCAGATCTCGAACGCGCGCTGGCCGCGCTCG
ACGTGCTCGTCGCACACACCGGAAGCTGGCCCGAGGCCGCGCGGCCCAACCTCCAACCACTCGTCTCACG
ATTCGAACGGAACGATGAAGCCACGGCAGGCGCGCACCACCATGCCGTACTGCCTACCTCATCGTCGTCG
TCATCGCGGGCACCGGCTTCTGGCTCGATCACTTCGACGCGAGATCTGCTGGACCAGGCGCGCGCCATGG
CGACCTGGCTGCGGGATCAGGAAAACGGCTACCTGCCGTCCGTGCGACTCGTGCGCAGCGTGCGCTGGGA
CACGCTGCATGAAGTGCCGCCCACCGACGCGACAGGCCGCACGCGTCTGGCGCCGCCGCGCATGGAGTTG
CGGCAGCAGCTCAAGCGGCTCGTGCTGCAGAAGCAGTGGCACGAACTGCTCGAACGCATCGAAGGCGCTT
TTATGGAGGGAGTCAATCACCTGTGGCTCGATCTGCAGTACTTCCAGCACGTTGCGCTGGATAGCGTCGG
CGCACCGTACAGCACGTGGCGCGACATGCTGCGCGCGGACTTCGCGCTGTTCCTCGAACGGCTGCCTGGC
ATTGAACGGCTGGCGTTCAACGACGGCACTCCGTTCGCCGACGACGTGACGCTCGAATGGATCGCGCGGC
ACGCTGTCGTGCGCGATCTGGAAGCGGGCGAATTGCTGGCGTCGCTTCCGGTGTCCGCCGATAGCGAGGA
CGGCGCAATCGGCGACTGGCCGGAGATCGAGCTGCAAGCGCGGGAACTGGCTGGACGAGATGGCATCGAG
GCCGCTTTCGCCTGGCTGGAAGCGCTGCCAGGGATGAAGACCGACCGTCATCGCTACCTGCAGCGGCTCG
TGATGGCGCGCGTGGCCGATCACGCGGGCCGCGCTGACACGGCACTGGCCCTGCTCGCCGAGCTCGATGC
CGGCACGCGTTCGTTACCGCTCGCGCGCTGGGAGCCGGCACTTGTCTTCGAGATCAAGCAGCAACTGGTC
AGAGCGCTCAAGACGATGAGCAACCGCAAGGATGCCGACAAGCCAGGCCTTGCGCGTCGCATCGGCGAAT
TGCAGGCGGAACTCACCGTGCTCGATCCGGCGCGCTCGCTGACCCTTTCGTAA