SecReT6
Protein ID: 407712940
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01747
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1376893..1378719 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDK0DNA8
KEGG IDbpx:BUPH_01747
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-176, Aligned region: 8..607
Protein Sequence: 608 a.a.     [Download]
>gi|407712940|ref|YP_006833505.1| type VI secretion system protein ImpG [Burkholderia phenoliruptrix BR3459a]
MKNDDPILRYYEMEMRYLRESGKEFAKAHPDRARMLNLDRVGDRDPYVERLYEGFAFLTARLQQKLDDEL
PELTEGLVSLLWPHYLRMIPSLSVVELIPLAEKLQRTDVVPAGVPVRSAPIAVPLVPGSEGTTPKTVQCL
YRTTQPVTLQPVAITHAGPTVRHDGRSVVRLGFALDASARRQETDLSRLRLYLNADLPTAFAMHLALTRQ
VDSIAWRIEEANHGQAAGEALPLTGVTLEPAGFSTEERLWSKSDAAFSGYQLLLEYFTFREKFLFVDLRG
IDITKLPEKATRFELEILLKHTYPSDQRFTAENVRLFCAPVINLFELDAEPIEIDHHETEYRVVPAGHQG
EHVETYSVDAIEAFDHETAQRYEYAPFTTFRHRGGMLRHEAPERYFHARVRPGVSGLHETWVILGGHAWE
SMATLPEESLSLRVTGTNGMLPRKGLREASIAELAASTPNVVGVSNLVAPTLPLYPPTGDRFQWRVLSHL
APNFLSMMNAEVLRGALALYDWTHDELNRRRLAGILWVSQELLEEVSGGAVERGVLIEVTLDSHAFAGEG
DVMLSGELLHRFFEQYAEINLFTKLSIVSLPLQTRTDWPRSKAQRAPL
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|407711772|ref|NC_018695.1|:1376893-1378719 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGAAAAACGACGATCCAATCCTGCGCTACTACGAAATGGAAATGCGCTATCTGCGCGAGTCGGGCAAGG
AATTCGCGAAAGCGCATCCTGACCGCGCGCGCATGCTCAACCTCGATCGCGTGGGCGACCGTGACCCGTA
TGTCGAGCGGCTCTATGAAGGTTTTGCATTTCTCACCGCGCGGCTCCAGCAGAAACTTGACGACGAACTG
CCTGAACTGACTGAAGGGCTCGTGAGCCTGTTGTGGCCGCACTACTTGCGGATGATCCCGTCGCTGTCGG
TGGTCGAGCTGATTCCGCTTGCGGAAAAGCTCCAGCGAACCGATGTCGTGCCGGCGGGCGTGCCGGTGCG
CTCCGCGCCGATAGCGGTGCCGCTCGTGCCAGGCTCTGAGGGTACGACGCCGAAGACGGTGCAGTGCCTG
TACCGGACCACGCAGCCGGTCACACTCCAACCGGTTGCCATCACGCACGCCGGCCCGACCGTGCGCCACG
ACGGCCGTTCTGTGGTCCGGCTCGGGTTTGCGCTGGACGCGTCGGCGCGTCGCCAGGAAACGGATTTGTC
GCGGTTGCGGCTGTACCTGAATGCGGACCTGCCGACCGCGTTCGCGATGCATCTCGCGCTCACGCGCCAG
GTCGATTCAATCGCGTGGCGTATCGAGGAAGCGAACCATGGCCAGGCCGCCGGCGAAGCATTGCCGCTTA
CCGGTGTCACGCTCGAGCCAGCCGGGTTCTCGACCGAAGAGCGCCTATGGTCGAAGTCCGATGCGGCGTT
CTCGGGCTACCAGTTGCTCCTCGAGTACTTTACTTTTCGCGAGAAGTTCCTCTTTGTCGACCTCCGCGGG
ATCGATATCACGAAACTGCCTGAGAAGGCGACCCGCTTCGAGCTCGAGATCCTGCTCAAGCATACGTATC
CGTCGGACCAGCGTTTTACCGCGGAGAACGTGCGGCTCTTCTGCGCGCCGGTCATCAACCTCTTCGAACT
CGACGCAGAGCCGATCGAAATCGATCACCACGAGACGGAATACCGGGTGGTGCCGGCCGGCCATCAAGGG
GAGCACGTCGAAACATACTCGGTCGATGCGATCGAGGCGTTCGATCACGAAACCGCGCAACGGTACGAAT
ACGCACCGTTCACAACGTTCCGGCACCGCGGCGGCATGCTGCGTCACGAAGCGCCGGAGCGCTACTTTCA
TGCTCGCGTACGCCCCGGCGTCTCCGGGCTGCACGAGACGTGGGTCATTCTCGGCGGTCATGCGTGGGAA
TCCATGGCTACGCTGCCTGAGGAAAGCCTCTCGCTGCGCGTAACGGGTACGAACGGCATGCTGCCGCGCA
AGGGGCTGCGCGAAGCGAGCATCGCCGAGCTTGCGGCGAGCACGCCGAACGTCGTGGGTGTGAGCAATCT
CGTTGCCCCGACGCTTCCGCTCTATCCGCCGACCGGCGACCGCTTTCAGTGGCGGGTGCTGTCGCATCTG
GCACCGAATTTCCTCTCGATGATGAACGCGGAAGTACTGCGCGGCGCGCTCGCGCTCTACGACTGGACTC
ATGACGAACTGAACCGCCGGCGTCTCGCCGGCATTCTGTGGGTTTCACAGGAACTGCTCGAAGAGGTCTC
GGGCGGCGCTGTCGAACGCGGTGTGCTCATCGAAGTGACCCTTGATTCCCATGCATTCGCCGGTGAGGGC
GATGTCATGCTCTCTGGTGAGCTGCTGCATCGCTTCTTCGAGCAGTATGCGGAGATCAATCTGTTTACGA
AGCTGTCGATCGTGAGCCTGCCGTTGCAAACGCGCACGGACTGGCCGCGCAGCAAGGCACAGAGGGCGCC
GCTATGA