SecReT6
Protein ID: 407712941
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01748
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1378716..1379849 [+]
Producttype VI secretion system protein ImpH
NoteTssG
UniProt IDK0DPH0
KEGG IDbpx:BUPH_01748
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.00E-80, Aligned region: 24..345
Protein Sequence: 377 a.a.     [Download]
>gi|407712941|ref|YP_006833506.1| type VI secretion system protein ImpH [Burkholderia phenoliruptrix BR3459a]
MKLRELPDLDPPNLDPLVASLLTRAPKMNFMQLCRLLEVRVPARPGFGTCDTPEHEPVRFRPRPRTGFPA
GEVASVEFDDGTDIFGPAFGSRLPPTVRTTFMGLYGVDAAMPPHMIDDIVLREEGHEAVEAFLDQFHHRV
VTLLYRAWKKYRYAESFRAGGSDAHSRNLLCLAGFGLGDKPQRAGLPDSRMLALLGLLIQRTRTSEGLAR
VVALAVPGVGVRVDEFFPVLTRAGQPRPLTSGGRASVPEDRAQPGLGGSYVLGRRLVHRGRAVRVILRPA
DAQQAHELLPGATLHRELLGYVQLYVGAKADVHLRMEVSSRLAPKPAIGHPSGGPVPRLAWTTVLPADEE
RLINIALGVYEAFPKPAPNPHLAPRHA
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|407711772|ref|NC_018695.1|:1378716-1379849 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGAAATTGCGCGAGTTGCCCGATCTCGATCCGCCGAATCTGGACCCGCTGGTCGCATCACTGCTCACCC
GCGCCCCGAAGATGAACTTCATGCAGCTGTGTCGTCTGCTCGAGGTGCGTGTACCGGCGCGTCCGGGCTT
CGGCACGTGCGATACACCTGAGCACGAACCGGTTCGCTTCAGGCCGCGTCCCCGCACGGGGTTTCCGGCC
GGTGAAGTAGCGTCAGTGGAGTTCGATGACGGGACAGATATCTTCGGCCCTGCGTTCGGCTCCCGCTTGC
CGCCCACTGTGCGCACCACGTTCATGGGCTTGTACGGCGTCGACGCAGCGATGCCTCCACACATGATCGA
CGATATCGTGCTGCGGGAGGAAGGGCACGAGGCCGTCGAGGCTTTTCTGGATCAGTTCCATCACCGCGTG
GTCACGCTGTTGTACCGCGCATGGAAGAAGTACCGCTACGCCGAGAGTTTCCGCGCGGGCGGCAGCGATG
CGCATTCACGTAATCTGCTGTGCCTGGCCGGCTTTGGCTTGGGCGATAAACCTCAGCGCGCTGGCTTGCC
GGATTCGCGGATGCTCGCATTGCTGGGCTTGCTGATTCAGCGTACGCGAACGTCGGAAGGCCTCGCGCGC
GTCGTCGCGCTCGCCGTCCCTGGCGTCGGCGTGCGCGTCGACGAATTCTTTCCCGTACTCACGCGGGCAG
GGCAGCCGCGGCCGCTGACGTCCGGCGGCCGTGCTTCGGTTCCAGAAGACCGTGCGCAGCCCGGTCTTGG
GGGCAGCTACGTGCTCGGCAGGCGGCTCGTCCATCGCGGCCGGGCAGTGCGGGTCATCTTGCGCCCGGCC
GACGCGCAGCAGGCCCACGAGCTGCTGCCCGGGGCCACGCTTCATCGTGAGTTGCTGGGGTACGTGCAAC
TGTACGTGGGCGCGAAAGCGGACGTGCACCTGCGCATGGAAGTGTCGTCGCGGCTTGCACCTAAGCCAGC
CATCGGTCACCCGTCAGGCGGACCGGTGCCGCGCCTCGCGTGGACCACTGTGCTTCCCGCCGACGAGGAA
CGCCTGATCAATATCGCGCTCGGCGTCTACGAAGCATTCCCGAAGCCAGCGCCTAATCCACACCTGGCAC
CGCGCCATGCCTGA