SecReT6
Protein ID: 407712942
SecReT6 ID707
T6SS typei2
Gene symbol-
Locus tagBUPH_01749
StrainBurkholderia phenoliruptrix BR3459a
Repliconchromosome I [GenBank: NC_018695] [Browse all T6SS(s) in this replicon]
Location [Strand]1379863..1380393 [+]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDK0DKK3
KEGG IDbpx:BUPH_01749
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.80E-36, Aligned region: 13..161
Protein Sequence: 176 a.a.     [Download]
>gi|407712942|ref|YP_006833507.1| type VI secretion system protein VasD [Burkholderia phenoliruptrix BR3459a]
MSIRFATSTLASALLLSACGAWQSVSDASSSAYHAVFFKQIKVLKVDLSAREALNPDDAGRPTSVAVRVY
QLKDRKMFDGASYEDLLKNDRIVLAQDLQASMASVLNPGASASLTQPMQADTNYVAIVAFYRNPGTGDGW
KYAIVRKKLDADKPLKLELVDQLLVASGSESQNSSR
 
Nucleotide Sequence: 531 bp     [Download]
>gi|407711772|ref|NC_018695.1|:1379863-1380393 Burkholderia phenoliruptrix BR3459a chromosome 1, complete sequence
ATGTCCATTCGTTTCGCTACCTCAACCCTCGCATCCGCTCTCCTGCTGTCGGCGTGCGGCGCGTGGCAGT
CCGTTTCCGACGCGTCGTCGAGCGCGTACCACGCTGTGTTCTTCAAGCAGATCAAGGTGCTCAAAGTCGA
TCTTTCCGCCCGCGAAGCATTGAACCCCGATGACGCCGGCCGCCCCACGTCGGTTGCGGTGCGCGTCTAT
CAGCTGAAGGACCGCAAGATGTTTGACGGCGCTTCGTACGAAGACCTTTTGAAAAACGACCGGATCGTGC
TTGCGCAGGATCTGCAGGCGAGCATGGCGTCCGTGCTGAACCCGGGTGCGTCTGCGAGCCTTACGCAGCC
GATGCAGGCTGACACCAACTACGTGGCTATCGTCGCGTTCTATCGCAATCCGGGCACGGGCGACGGCTGG
AAATACGCAATCGTCAGGAAGAAGCTCGACGCCGACAAGCCGTTGAAGCTCGAGCTGGTCGACCAGTTGC
TTGTTGCGTCGGGCAGTGAGTCTCAGAACAGCTCCCGGTGA