SecReT6
Protein ID: 409249526
SecReT6 ID768
T6SS typei1
Gene symbolhcp5
Locus tagSENTW_1057
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]51021..51500 [-]
ProductMajor exported protein Secreted protein hcp
NoteTssD
UniProt IDE9A082
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-29, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|409249526|ref|YP_006885351.1| Major exported protein Secreted protein hcp [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MANLIYLTLNGEKQGLISAGCCSLDSIGNKAQLLHLDHIMVYELTHGLSRDQNVNHHSVTIKKPVDKSSP
LLGKAINDNEILTCTFDFYRTNRFGINEKYYKLELKKARISDINFSIAHVVIDSEAQPQESISFIYESIN
WEHCIAGTSAFSLWDERVF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c51500-51021 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGCCAATTTAATTTATTTAACACTGAACGGTGAAAAGCAAGGATTGATTTCAGCAGGTTGTTGTTCCC
TTGACTCTATCGGTAATAAAGCACAGTTACTGCACCTTGATCATATTATGGTATATGAACTGACACATGG
GTTAAGTCGGGATCAAAATGTCAATCATCATTCAGTTACGATAAAAAAACCTGTCGATAAATCATCTCCT
TTACTGGGAAAAGCAATTAACGATAATGAAATATTGACCTGCACTTTTGATTTTTATCGAACAAATCGAT
TTGGTATTAATGAAAAATATTACAAACTGGAATTAAAAAAAGCCCGAATTAGTGATATTAATTTCTCGAT
TGCGCATGTAGTCATTGACAGTGAAGCACAACCTCAGGAAAGTATTTCTTTTATATATGAATCCATAAAC
TGGGAACACTGTATTGCCGGGACCAGTGCATTCAGTTTATGGGATGAGAGGGTGTTTTAG