SecReT6
Protein ID: 409249527
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1058
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]51516..52880 [-]
Producthypothetical protein
NoteTssA
UniProt IDE9A083
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.80E-45, Aligned region: 93..156
DUF3702 [PF12486], Evalue: 2.80E-45, Aligned region: 262..271
DUF3702 [PF12486], Evalue: 2.80E-45, Aligned region: 292..438
ImpA-rel_N [PF06812], Evalue: 3.00E-21, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 3.00E-21, Aligned region: 240..265
Protein Sequence: 454 a.a.     [Download]
>gi|409249527|ref|YP_006885352.1| hypothetical protein SENTW_1058 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKLVESLALAIFKAHGVDLHTATYYTLAR
TRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNSRTGNILRQQLSFSGADLPLLYRTERA
LQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSSVDISPQTTVRTLIYAPESTQPVTEENLPPL
PELPEMKVEVHHGAVEDTEPVARATSGRTIKGFMAGVVCAAAVAAVLWWWQVYPMQQQLAQVRDTAQGAA
TLWLASPELDSYGQRLQQLPDASPLQLLEAGMQMTHTADSRWPESLQQQQATAQWNEILKTRAQSSPQMR
GWQQARQNLRDFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQYQDARAQGRNAEVLEK
QINERLDGVLSRWLLLKNNVVPETATKAPPENNS
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c52880-51516 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGAGTCAGGACGCACTCACGCACATTATTGTTACCGGCCAGGATCCGCGCGGCCTGCCGGAGTTCAGCG
CCCTGCGGGAAGAGATCAACAAATCGTCTCACCCGTCGCAGCCGGAGCTGAACTGGAAACTGGTGGAATC
GCTGGCGCTGGCCATTTTTAAAGCCCATGGCGTGGATCTGCACACGGCCACCTACTACACCCTGGCGCGC
ACCCGCACGCACGGCCTGGCCGGATTTTGCGAAGGGGTGGAGCTGCTGGCGGCCATGATAAGCCACGACT
GGGACAAATTCTGGCCGCAGGATGAGTCAGCCCGCACCGGGATGCTCGACTGGCTTAATTCGCGCACCGG
TAATATTCTGCGCCAGCAGCTGTCCTTCTCCGGCGCGGACCTGCCGTTACTGTACCGCACCGAGCGGGCG
TTACAGTTGATTTGCGACAAACTCCAGCAGGTGGAACTGAAACGCCAGCCGCATGTGGAGAACCTGCTTT
ATTTTGTGCAGAACACACGTAAGCGGCTTGAGCCGCCGCCGAAAAGCAGCGTGGACATTTCGCCGCAGAC
CACCGTCAGAACGTTGATCTACGCCCCGGAGAGTACGCAGCCCGTCACGGAGGAAAACCTTCCGCCCCTG
CCTGAGTTGCCGGAAATGAAGGTGGAAGTCCACCACGGCGCGGTGGAGGATACAGAGCCTGTCGCCAGGG
CCACGTCAGGCCGGACTATAAAAGGCTTTATGGCCGGTGTCGTCTGCGCTGCGGCTGTCGCTGCCGTCCT
CTGGTGGTGGCAGGTGTACCCGATGCAACAGCAACTGGCGCAGGTCAGGGACACGGCGCAGGGCGCGGCA
ACGCTCTGGCTGGCTTCGCCTGAACTGGACAGTTACGGGCAACGGTTACAACAGCTTCCCGACGCCTCGC
CGCTGCAACTGCTGGAGGCGGGGATGCAGATGACGCATACCGCAGACAGCCGCTGGCCGGAGAGTCTGCA
ACAGCAGCAGGCGACAGCGCAGTGGAATGAAATCCTGAAAACCCGCGCGCAAAGCAGCCCGCAAATGCGC
GGCTGGCAGCAGGCGCGCCAGAATCTGCGTGACTTTGCTGACCTGATGATGCAGCGGGAAACGGAGAAGC
AGGGCTTTACCCTCTCCTATATTAAAACGGTGACCTGGCAGGCGGAACGCCTGCTGAACCAGGAAACGCC
GCTGGAGTCCCTGCTGACGCAGTACCAGGATGCCCGCGCTCAGGGACGGAATGCGGAGGTGCTGGAAAAA
CAAATTAATGAACGGCTGGATGGGGTGTTAAGCCGCTGGCTGTTGCTGAAAAACAATGTAGTGCCGGAAA
CGGCAACTAAAGCCCCCCCCGAAAATAATAGTTAA