SecReT6
Protein ID: 409249529
SecReT6 ID768
T6SS typei1
Gene symbolCAD
Locus tagSENTW_1060
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]56419..57831 [-]
ProductCAD protein Includes: Glutamine-dependent carbamoyl-phosphate synthase; Includes: RecName: Full=Aspartate carbamoyltransferase; Includes: RecName: Full=Dihydroorotase
NoteTssA
UniProt IDE9A085
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.20E-09, Aligned region: 52..109
ImpA-rel_N [PF06812], Evalue: 4.20E-09, Aligned region: 395..407
Protein Sequence: 470 a.a.     [Download]
>gi|409249529|ref|YP_006885354.1| CAD protein Includes: Glutamine-dependent carbamoyl-phosphate synthase; Includes: RecName: Full=Aspartate carbamoyltransferase; Includes: RecName: Full=Dihydroorotase [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MDLRDPNTWISHLLENLPDDKLACALKDDDPDWEYIDGEMLKLGSLAHSQLDIPEIQRRGLVILASESKD
FRLLAHLLRTLQHAGDPLLALRLLALYVEHYWTVAAPQNAAHKQRFATQVLKRFETGVESFAETARTAQR
DSLLAELAKLAQRWQEQNIPALAQAVDDLSSQYRRAFRGAAPVPPAAGPSTPPAPVSATPSAPVSPSAPA
AATAPAVDIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQAITSVPQAESDGRTPLAAVPAD
MTADYQARLNNADLALWQQVEKSLLLAPYWLDGHYLSAQTAQRLGYTSAAEAIRDEVVRFLARLPQLATL
LFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVRQCFSEQGLEAALRYLETLPEGDPRDRFHRQY
LGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLLEQLENKLTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c57831-56419 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGACTTACGCGACCCGAATACCTGGATTTCGCACCTGCTGGAAAATCTGCCGGATGACAAACTGGCCT
GCGCGCTGAAAGACGATGATCCTGACTGGGAATATATCGACGGCGAAATGCTTAAACTCGGCTCGCTGGC
GCACAGCCAACTGGATATCCCGGAAATTCAGCGCCGGGGGCTGGTGATTCTGGCCTCGGAAAGCAAGGAT
TTTCGCCTGCTGGCCCATCTGCTGCGCACCCTGCAACATGCCGGCGATCCGCTGCTGGCGCTGCGTCTGC
TGGCGCTGTACGTGGAGCATTACTGGACGGTGGCGGCACCACAAAATGCGGCACATAAACAGCGTTTCGC
CACCCAGGTGCTGAAACGCTTTGAAACCGGCGTGGAGAGTTTCGCAGAGACAGCCCGTACCGCGCAGCGC
GACAGCCTGCTGGCTGAACTGGCGAAACTGGCGCAGCGCTGGCAGGAGCAGAATATCCCGGCGCTGGCAC
AGGCCGTCGATGACCTCTCGTCGCAGTATCGCCGGGCATTTCGCGGAGCCGCCCCGGTGCCGCCAGCGGC
TGGCCCGTCCACGCCTCCGGCTCCGGTTTCGGCCACGCCGTCCGCCCCGGTATCCCCGTCTGCGCCTGCG
GCGGCGACGGCGCCAGCGGTGGATATCGACAGCCATGACGACAAAGCCTGGCGCGACACGCTGCTGAAAG
TGGCCGCCATTCTCTGTGAGCGCCAGCCGGATTCACCGCAGGGCTACCGCCTGCGCCGCCATGCGTTATG
GCAGGCCATTACATCCGTCCCCCAGGCCGAAAGCGACGGGCGCACACCGCTGGCGGCGGTGCCTGCCGAC
ATGACCGCCGATTACCAGGCGCGGCTGAACAACGCCGATCTGGCGCTCTGGCAACAGGTGGAAAAAAGCC
TGCTGCTGGCACCGTACTGGCTCGACGGTCATTACCTTTCAGCGCAGACCGCACAACGCCTGGGCTACAC
CAGCGCGGCAGAAGCCATCCGGGATGAGGTGGTTCGCTTTCTCGCCCGCCTGCCGCAACTTGCCACCCTG
CTGTTTAATGACCGCACGCCGTTTATCAGCGAACAGACAAAGCAGTGGCTGGCGGCGTCTCCGGGCAGTC
AGACAGCCCCGATGGTGCGGACCAGTGAAGACACCGAGGCCGTCCGCCAGTGTTTCAGCGAGCAGGGGCT
GGAGGCCGCGCTGCGATACCTGGAAACCCTGCCGGAAGGCGATCCGCGCGATCGGTTCCACCGGCAGTAT
CTTGGCGCGCAACTGTTAGAAGAAGCCGGGATGGCGCAACTGGCACAGCAACAGTACCGGATGTTGTTTA
AAGCAGGGCTGCGCATGACGCTGGCTGAATGGGAGCCGTCCCTGCTGGAACAACTGGAAAACAAACTCAC
GGCAGAACAGTAA