SecReT6
Protein ID: 409249531
SecReT6 ID768
T6SS typei1
Gene symbolclpB1
Locus tagSENTW_1062
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]58567..59184 [-]
ProductChaperone protein clpB
NoteTssH
UniProt IDE9A087
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.20E-17, Aligned region: 2..85
ClpB_D2-small [PF10431], Evalue: 1.80E-13, Aligned region: 91..168
AAA_5 [PF07728], Evalue: 0.0019, Aligned region: 2..50
AAA_5 [PF07728], Evalue: 0.0019, Aligned region: 102..113
Protein Sequence: 205 a.a.     [Download]
>gi|409249531|ref|YP_006885356.1| Chaperone protein clpB, partial [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNVVFFLTSNLGYQVIVEHADNPEAMQEALYPV
LADFFKPALLARMEVVPYLPLSKETLAVIIAGKLARLDNVLRARFGAEVVIEPEVTDEIMQRVTRAENGA
RMLESVIDGEMLPPLSLLLLQKMAANIAIARITLGVANGAFTADVEDVPDEDTQPVTETEDEAVL
 
Nucleotide Sequence: 618 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c59184-58567 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
GTGGTGCTGCTCGACGAGGTGGAGAAAGCCCACCCGGACGTGCTTAACCTGTTCTACCAGGCGTTCGACA
AGGGCGAGATGGCCGACGGCGAAGGCCGTCTTATCGACTGCAAAAATGTGGTGTTCTTCCTCACCTCCAA
CCTCGGCTATCAGGTGATTGTCGAACATGCCGACAACCCGGAAGCCATGCAGGAAGCGCTGTACCCGGTA
CTGGCGGACTTCTTTAAACCGGCGCTGCTGGCGCGTATGGAAGTGGTGCCGTACCTGCCGTTATCTAAAG
AAACGCTTGCCGTCATTATCGCCGGGAAGCTGGCGCGGCTGGATAACGTGCTGCGCGCCCGCTTCGGCGC
GGAGGTGGTGATTGAGCCGGAGGTGACCGACGAAATCATGCAGCGCGTCACCCGCGCCGAAAACGGCGCG
CGGATGCTGGAGTCGGTCATCGACGGCGAGATGCTGCCGCCGCTCTCCCTGCTGCTGTTGCAGAAAATGG
CGGCGAATATCGCCATTGCCCGTATCACGCTGGGCGTGGCAAACGGCGCGTTTACTGCGGATGTGGAGGA
TGTGCCGGATGAGGATACTCAGCCTGTGACGGAAACAGAGGACGAAGCCGTTCTATGA