SecReT6
Protein ID: 409249532
SecReT6 ID768
T6SS typei1
Gene symbolclpB3
Locus tagSENTW_1063
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]59138..61303 [-]
ProductChaperone protein clpB
NoteTssH
UniProt IDE9A088
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA [PF00004], Evalue: 2.00E-11, Aligned region: 30..57
AAA [PF00004], Evalue: 2.00E-11, Aligned region: 223..334
AAA [PF00004], Evalue: 2.00E-11, Aligned region: 636..656
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 25..66
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.80E-08, Aligned region: 634..659
AAA_16 [PF13191], Evalue: 6.40E-08, Aligned region: 25..61
AAA_16 [PF13191], Evalue: 6.40E-08, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 6.40E-08, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 6.40E-08, Aligned region: 466..482
AAA_16 [PF13191], Evalue: 6.40E-08, Aligned region: 610..656
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 282..307
AAA_25 [PF13481], Evalue: 3.60E-06, Aligned region: 630..673
AAA_5 [PF07728], Evalue: 3.60E-05, Aligned region: 222..244
AAA_5 [PF07728], Evalue: 3.60E-05, Aligned region: 635..659
NACHT [PF05729], Evalue: 7.90E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 7.90E-05, Aligned region: 281..345
NACHT [PF05729], Evalue: 7.90E-05, Aligned region: 636..669
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 367..398
AAA_19 [PF13245], Evalue: 0.0001, Aligned region: 627..669
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 0.00021, Aligned region: 633..657
DUF258 [PF03193], Evalue: 0.00037, Aligned region: 191..239
DUF258 [PF03193], Evalue: 0.00037, Aligned region: 636..650
Clp_N [PF02861], Evalue: 0.00059, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.00059, Aligned region: 117..123
AAA_18 [PF13238], Evalue: 0.00073, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.00073, Aligned region: 636..674
AAA_14 [PF13173], Evalue: 0.0013, Aligned region: 222..323
AAA_14 [PF13173], Evalue: 0.0013, Aligned region: 635..669
AAA_17 [PF13207], Evalue: 0.0041, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0041, Aligned region: 636..661
IstB_IS21 [PF01695], Evalue: 0.0067, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0067, Aligned region: 635..646
Protein Sequence: 721 a.a.     [Download]
>gi|409249532|ref|YP_006885357.1| Chaperone protein clpB [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MIQIDLATLVKRLAPFAKQALEAAASECMSQQAAEITVAHVLLQMLATPRSDFRVIAERAEIGADDLRQA
LTVENYAATRSSDSYPSFSPMLVEWLKEAWLLASAEMQQTELRGGVLLLALLHSPLRYLPPAAARLLTAI
NRDLLRQDFAGWTKESAESVILNADGQAASAIADTGDTLLARYAKNMTDDARQGRLDPVLCRDNEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIIAGQVPDKLRDTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVIQSPKPAILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDEALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPRQISALTTLRQQCEAEIRQLEREIRIGLRSDTSRLNEVLVQYDETLTELEALEAAWRQQQTL
VQEIIALRKGLLDETDATGNDETATPETEAVGSDDESVTAPPEAEPEMSPAARLAQLTAELDALHHTQLL
VSPHVDKKQIASVIAEWTGVPLNRLSQNEMSVITDLPQWLGDTIKGQALAIKHLHKHLLTARADLRRPGR
PLGAFLLAGPSGVGKTETVLQLAELLYGGAPVPDHHQYVGVSGETHRFTPDWFPARLCRLRRGRRADRSD
SSETVLRGAARRGGESPPGRA
 
Nucleotide Sequence: 2166 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c61303-59138 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGATCCAGATTGACTTAGCCACCCTGGTAAAACGGCTTGCTCCCTTCGCGAAACAGGCGCTGGAAGCGG
CGGCATCGGAGTGTATGAGCCAGCAGGCGGCAGAAATTACCGTCGCGCATGTGCTGCTACAGATGCTGGC
GACCCCGCGCAGCGACTTTCGGGTGATTGCCGAACGTGCGGAGATCGGCGCCGATGATTTACGCCAGGCG
CTGACGGTGGAAAATTACGCCGCTACCCGTTCATCTGACAGCTACCCGTCGTTTTCCCCGATGCTGGTTG
AATGGCTGAAAGAGGCCTGGCTGCTGGCCTCTGCGGAAATGCAGCAGACCGAACTGCGCGGCGGCGTGCT
GCTGCTCGCCCTGCTGCATTCGCCGTTGCGCTACCTGCCGCCCGCCGCCGCCCGGCTGCTCACCGCCATC
AACCGCGACCTGCTCCGGCAGGATTTTGCCGGGTGGACGAAGGAGTCCGCCGAATCGGTGATCCTGAATG
CGGACGGACAGGCCGCCAGCGCCATAGCCGATACCGGCGACACCCTGCTGGCCCGCTATGCCAAAAATAT
GACCGACGATGCCCGGCAGGGGCGGCTTGATCCGGTGCTGTGCCGCGATAACGAAATTGATCTGATGATC
GATATCCTCTGCCGCCGCCGTAAAAATAACCCGGTAGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATTATTGCCGGTCAGGTGCCGGACAAACTGCGCGATACCGATATTAT
GACGCTGGATCTCGGCGCATTGCAGGCGGGCGCGTCGGTAAAAGGCGAGTTTGAGAAGCGCTTTAAGGGG
CTGATGGCGGAAGTCATTCAGTCGCCAAAACCCGCCATCCTGTTTATCGACGAAGCCCACACGCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCTAACCTGCTCAAACCGGCACTGGCGCGCGGCGAACT
GAAAACCATCGCCGCCACCACCTGGAGCGAATACAAAAAATACTTCGAGAAAGACGCCGCCCTGTCGCGC
CGTTTTCAACTGGTGAAAGTCAGCGAACCCAATGCTGCCGAAGCCACCATTATTCTGCGCGGCCTGTCGG
CGGTGTATGAGCAGTCCCACGGCGTGCTGATTGACGATGAAGCGTTACAGGCCGCCGCGACGTTAAGCGA
GCGCTACCTGTCAGGCCGCCAGTTGCCGGATAAAGCCATTGATGTGCTGGATACCGCCTGCGCCCGCGTG
GCGATTAACCTCTCCTCGCCGCCGAGACAAATCTCGGCGCTGACCACCCTGCGCCAGCAGTGTGAAGCGG
AAATCCGCCAGCTTGAGCGTGAAATTCGCATCGGCCTGCGGTCGGACACCTCACGGCTAAACGAGGTTCT
GGTGCAGTATGACGAAACGCTGACCGAACTGGAGGCGCTGGAGGCCGCGTGGCGCCAGCAACAGACGCTG
GTGCAGGAGATTATTGCGCTGCGTAAGGGGCTGCTGGACGAAACGGACGCTACCGGCAACGATGAAACCG
CAACGCCTGAAACAGAGGCGGTGGGCAGTGACGATGAATCCGTCACCGCGCCACCGGAAGCGGAACCTGA
AATGTCGCCAGCCGCCCGCCTCGCGCAGCTCACCGCCGAACTGGACGCCCTGCACCACACGCAGCTGCTG
GTCTCCCCGCACGTCGATAAAAAACAGATAGCCAGCGTGATTGCCGAATGGACCGGCGTGCCGCTTAACC
GCCTGTCACAAAACGAAATGTCGGTCATCACCGACCTGCCGCAGTGGCTGGGCGACACCATCAAAGGCCA
GGCGCTGGCGATTAAGCACCTGCATAAACACCTGCTCACCGCCCGCGCCGATCTGCGCCGTCCGGGACGT
CCGCTCGGCGCGTTCCTGCTGGCCGGTCCCAGCGGCGTCGGCAAAACCGAAACCGTGCTACAGCTGGCCG
AACTGCTCTACGGCGGTGCGCCAGTACCTGACCACCATCAATATGTCGGAGTTTCAGGAGAAACACACCG
TTTCACGCCTGATTGGTTCCCCGCCCGGCTATGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAAGCGAT
TCGTCAGAAACCGTACTCCGTGGTGCTGCTCGACGAGGTGGAGAAAGCCCACCCGGACGTGCTTAA