SecReT6
Protein ID: 409249533
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1064
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]61316..62074 [-]
Producthypothetical protein
NoteTssL
UniProt IDE9A089
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.40E-63, Aligned region: 30..234
Protein Sequence: 252 a.a.     [Download]
>gi|409249533|ref|YP_006885358.1| putative membrane protein [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MDELSLPPLPGYEREGQRQYQLALRGNSLNPMIDAATPLLGMVMRVSGMNSHAMPEHLFTQVVTDVQAVE
QLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLMREPK
RYQDLLEFLYICFSLGFRGRYKVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLIKR
LTIRHVLCGGIVVLALFYLFYLLRLDSQTQDILHQLNRLLAR
 
Nucleotide Sequence: 759 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c62074-61316 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGATGAGCTGTCACTGCCCCCTTTACCCGGATACGAGAGAGAAGGCCAGCGCCAGTATCAGCTGGCGC
TGCGCGGCAACAGCCTGAACCCGATGATCGATGCCGCCACCCCGCTGCTGGGGATGGTGATGCGCGTTTC
GGGCATGAACAGTCATGCCATGCCTGAACACCTGTTCACCCAGGTAGTGACGGATGTGCAGGCGGTGGAG
CAGTTACTCCAGGAGCAGGGCTATGAGCCTGGGGTGATTATCTCGTTTCGTTACATCCTGTGTACCTTTA
TTGACGAGGCGGCGCTGGGGAATGGCTGGTCGAACAAAAACGAGTGGATCAAGCAGTCGCTGCTGGTGCA
TTTCCATAACGAAGCCTGGGGCGGTGAAAAGGTTTTTATCCTGCTGGAGCGCCTGATGCGCGAACCCAAA
CGCTACCAGGATCTGCTGGAATTTTTGTATATCTGCTTTTCGCTGGGCTTTCGCGGGCGTTACAAAGTCG
CCGTCCAGGACCAGGGGGAATTTGAGCAGATATACCGCCGCCTGTATCACGTCCTGCATAAGCTGCGCGG
CGACGCGCCCTTTCCGCTGCTGCACCAGGATAAAAAAACCCAGGGCGGGCGCTATCAGCTGATTAAGCGG
CTGACCATCCGGCATGTTCTGTGCGGCGGCATCGTCGTGCTGGCGCTGTTTTATCTGTTTTATCTGCTGC
GTCTGGACAGTCAGACGCAGGACATTCTTCATCAGTTAAACCGGCTGCTTGCCAGGTAA