SecReT6
Protein ID: 409249534
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1065
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]62079..63410 [-]
Producthypothetical protein
NoteTssK
UniProt IDE9A090
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.40E-147, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|409249534|ref|YP_006885359.1| hypothetical protein SENTW_1065 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MATTRNKVMWREGTLMRPHHLQQQQRYNDYVNNLRFRAIHDLSWGFTELSLNDELLGQGKIMIDSASGTL
PDGTVFSLPDQDALPDPLHPDSFPDEESRNVYLALPVASDVRGEVSYGQQVGRYRLNDASVRDLHSENGD
ARTLTLGQLTPRIMSGADDMSAYVTLPLCRIKDRRADGSLMLDENFIPTCQNVYVSARLREFLREVQEAV
GGRANDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRPHLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHRNLTDTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSTLLQSATFVLAVAA
KMETLQLQRQFIQQSKISSPEKIRNMVSVQIPGIPLHTLMVAPRQLPYHAGFSYFELDKSGAAWADVAAT
GAVALHVSGTFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c63410-62079 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGCAACCACGCGAAACAAGGTGATGTGGCGGGAAGGAACGCTGATGCGTCCGCACCATCTCCAGCAGC
AACAACGTTATAACGATTATGTGAATAATCTGCGTTTCCGGGCCATTCATGATTTGTCCTGGGGATTTAC
CGAGCTTTCCCTCAATGATGAGCTGCTGGGACAGGGCAAAATTATGATCGACAGCGCGTCGGGCACCCTG
CCGGACGGCACCGTGTTTTCCCTTCCGGACCAGGATGCGCTCCCCGATCCGCTGCATCCGGACAGTTTTC
CTGATGAGGAAAGCCGCAATGTCTATCTGGCCTTACCCGTTGCCAGCGATGTGAGAGGCGAAGTCAGTTA
CGGGCAGCAGGTTGGGCGTTACCGGCTGAACGATGCCAGTGTCCGGGATCTGCATTCCGAGAATGGCGAT
GCCCGGACGCTGACGCTGGGCCAGTTGACCCCCCGCATTATGAGCGGAGCGGACGATATGAGCGCGTATG
TCACGTTGCCGCTGTGCCGTATCAAAGACAGGCGGGCGGACGGCTCCCTGATGCTGGATGAAAACTTTAT
CCCTACCTGCCAGAACGTTTATGTCAGCGCACGGCTGCGTGAATTTCTCCGGGAAGTCCAGGAAGCGGTT
GGCGGCCGGGCCAATGACCTGGCTAACCGCATTGGCTCTCCGGCGCAAAGCGGCATTGCCGACGTTGCGG
AATTTATGATGCTGCAACTGCTCAACCGTAACCAGACGCGGTTCACCCACCGCGCCCGCAGGCCGCACCT
CCATCCGGAAGATTTTTATCTCGATCTGGCCGGGCTGCTGGGCGAGCTGATGACATTTACCGAGCCATCC
CGCCTGCCCTGTCCGCTGGATGTCTACGATCACCGCAACCTGACGGACACCTTCAAAACGCTGTTGCCGG
AAGTGAAACGGGCATTACATACCGTCCTGTCGCCCAGGGCGGTTAACCTGCCGCTGCATCTGCGCGATGG
CATCTGGCAGGCTGACGTACATGACTCCACGCTGTTGCAGTCGGCCACCTTCGTGCTGGCGGTGGCGGCG
AAAATGGAGACGCTGCAACTCCAGCGCCAGTTTATCCAGCAGTCAAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGCGTGCAAATCCCCGGCATCCCGCTGCATACGCTGATGGTGGCCCCCCGCCAGCTTCC
GTACCATGCCGGTTTCAGCTATTTCGAACTGGACAAGAGCGGGGCCGCCTGGGCGGATGTGGCGGCCACC
GGCGCTGTCGCCCTGCATGTTTCCGGTACGTTCCCGGATCTGAACATGCAACTGTGGGCCATAAGAGGAT
AA