SecReT6
Protein ID: 409249536
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1067
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]63943..65229 [-]
Producthypothetical protein
NoteFha
UniProt IDE9A092
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 428 a.a.     [Download]
>gi|409249536|ref|YP_006885361.1| hypothetical protein SENTW_1067 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MAEEKARQQTLSLHVVNGNELESGRTARCLFTGDGDVGHGSECHWPVQDRHQNVPAKAFSISLHDGAFCL
HPLASPLWLNQAKVTAASDQVQLRQGDEIQTGHLILRVYLNQGGMRHYDEEMATPETIVSNHDLLSDTLL
STDGAPEYPGMPSRHQLADTVVNGFSTDPLQVLQAESLTTRDNPLAGITPARASAPLSDPAINGGINTPF
MDLPSMYADPHDNEEGMSPADAAQRHLAVTPLLRGLGGSLAVHNTQDADDFLEEAGRTLQAAIQGLLELQ
QRRNSLSDKHLRPLEDNPLRLNMDYATALDVLFAEGKSPVHLAAPAAVSESLRNIRHHEEANRAAIVESL
RVLLDAFSPQSLMRRFVQYRRSHELRKPLDDAGAWQMYCDYYDELASSRQQGFEMLFNEVYAQVYDRVLR
EKQREPEA
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c65229-63943 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGCGGAAGAAAAAGCGCGGCAACAGACGCTTTCACTGCATGTCGTTAACGGTAACGAGCTGGAGAGCG
GACGTACCGCACGGTGTCTGTTCACCGGAGACGGCGATGTGGGCCACGGCAGCGAATGCCACTGGCCTGT
TCAGGACCGGCACCAGAACGTTCCGGCGAAGGCGTTCAGCATCAGCCTGCATGATGGCGCATTCTGCCTG
CATCCGCTGGCATCGCCATTATGGCTGAACCAGGCTAAAGTCACGGCGGCCTCAGACCAGGTGCAGTTAC
GTCAGGGCGATGAGATCCAGACCGGGCATCTGATACTCCGGGTTTATCTGAACCAGGGCGGGATGCGGCA
TTACGATGAGGAGATGGCGACGCCTGAAACCATCGTTTCTAACCACGACCTCCTGTCGGACACGCTACTG
TCCACGGACGGCGCGCCGGAATATCCGGGAATGCCGTCCCGCCATCAGCTCGCGGATACCGTTGTTAATG
GCTTTTCCACCGATCCGTTGCAGGTGCTCCAGGCTGAAAGTCTGACCACCAGGGACAATCCGCTTGCGGG
TATCACCCCGGCCCGGGCCTCCGCCCCGTTATCCGATCCGGCGATAAACGGCGGGATCAACACGCCGTTT
ATGGATCTGCCGTCCATGTATGCCGATCCGCATGATAATGAAGAGGGCATGTCACCGGCAGACGCGGCGC
AGCGCCACCTCGCCGTCACGCCGTTACTGCGCGGGCTGGGGGGATCGCTTGCCGTGCATAACACCCAGGA
CGCCGATGATTTTCTGGAGGAGGCCGGAAGGACATTGCAGGCGGCGATTCAGGGGTTGCTTGAGCTACAG
CAGCGCCGCAACAGCCTGTCAGACAAGCATCTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAATATGG
ACTACGCCACGGCGCTGGACGTGCTGTTTGCCGAAGGGAAAAGCCCGGTACATCTGGCCGCGCCCGCCGC
CGTCAGCGAGAGCCTGCGCAATATTCGTCATCACGAAGAAGCCAACCGCGCCGCGATTGTGGAATCGCTG
CGCGTGCTGCTGGACGCCTTCTCGCCACAGAGTCTGATGCGCCGTTTTGTGCAGTACCGCCGCAGCCACG
AACTGCGTAAACCGCTGGATGATGCCGGTGCGTGGCAGATGTACTGCGATTATTACGATGAGCTGGCCTC
CAGCCGCCAGCAGGGTTTTGAGATGCTGTTTAACGAAGTGTATGCCCAGGTGTATGACCGGGTGTTGCGT
GAAAAGCAGCGGGAGCCGGAAGCATGA