SecReT6
Protein ID: 409249537
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1068
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]65254..66342 [-]
Producthypothetical protein
NoteTssG
UniProt IDE9A093
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-88, Aligned region: 34..349
Protein Sequence: 362 a.a.     [Download]
>gi|409249537|ref|YP_006885362.1| hypothetical protein SENTW_1068 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MGGKNRATPAHLSPDETPAQDEQRTLREPLFQDACACNFFALSELLHRLASEGGETPALSLDTPPAQETI
RFLADASLGFPVSDVSALEQDASGLFRMTTTFMGLQGSQSPLPGYYLDHLAWKSAHEQSPVSDFLDMFSH
RLTQFVWHIWRKYRYHVAFRNGGVDAFSQRMYSLVGLGHRQLRDSLPVNHSKMLAYAGILANPGRSPEIV
CTLVAHCFDLNLSDVTLQNWQRRMVDIEPDQQNSLGCYTIKNGEKLAGRSVLGNFVLGTRVPDLSGKFQL
SINHLSRKQFLSFLPSGENFLPLAMFVSFVLRDQLAWDLHLGLAPDQVGIMRLGDNKSALLGWTSFLGEP
GEHPSVTIRVRE
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c66342-65254 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGGCGGAAAGAACCGGGCAACACCCGCTCATCTGAGTCCGGACGAGACTCCGGCGCAGGATGAACAAC
GCACGCTGCGGGAGCCGTTGTTTCAGGATGCCTGCGCCTGCAATTTTTTCGCGCTCTCTGAGCTGCTGCA
CCGGCTGGCATCAGAAGGCGGCGAAACGCCGGCGTTATCCCTGGATACCCCTCCGGCGCAGGAAACCATT
CGTTTCCTGGCGGACGCCAGCCTGGGATTTCCGGTAAGCGATGTCAGCGCGCTGGAGCAGGATGCTTCCG
GGTTGTTCCGGATGACCACCACCTTTATGGGATTGCAGGGCAGCCAGTCGCCCCTCCCCGGCTATTACCT
TGATCACCTGGCCTGGAAATCCGCGCACGAGCAGAGTCCGGTCAGCGATTTTCTGGATATGTTCAGCCAT
CGCCTGACGCAGTTTGTCTGGCATATCTGGCGTAAGTACCGTTACCACGTCGCTTTCCGTAACGGCGGCG
TGGATGCATTCTCGCAGCGGATGTACTCCCTGGTGGGGCTGGGCCACCGGCAGCTTCGCGACAGCCTGCC
CGTTAACCACAGCAAGATGCTGGCCTATGCCGGGATACTGGCAAATCCGGGACGTTCGCCGGAGATCGTC
TGCACGCTGGTTGCGCACTGTTTCGATTTAAATTTATCGGACGTGACGCTGCAAAACTGGCAGCGGCGGA
TGGTGGATATCGAGCCGGATCAGCAGAACAGTCTTGGATGTTACACGATTAAAAATGGCGAAAAACTGGC
CGGGCGATCGGTGCTGGGCAATTTTGTCCTCGGTACGCGGGTTCCCGATCTCAGCGGTAAATTTCAGTTA
AGTATTAACCACCTGAGCCGCAAGCAGTTTCTCTCGTTCCTGCCGTCAGGAGAAAATTTTCTGCCGCTGG
CGATGTTTGTCTCCTTCGTCCTGCGCGATCAGCTTGCCTGGGATTTACACCTGGGGCTGGCCCCGGATCA
GGTGGGGATTATGCGGCTGGGCGATAACAAGAGCGCGCTGCTGGGCTGGACGTCATTTCTCGGCGAGCCG
GGAGAGCATCCCTCAGTCACCATCAGGGTCAGGGAGTAA