SecReT6
Protein ID: 409249538
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1069
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]66306..68159 [-]
Producthypothetical protein
NoteTssF
UniProt IDE9A094
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-191, Aligned region: 5..617
Protein Sequence: 617 a.a.     [Download]
>gi|409249538|ref|YP_006885363.1| hypothetical protein SENTW_1069 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIRMLWPNYLRPVPSMTLIEYAPDMDKTSVPVLIPRNEQFTTGAKGTQGNAVLSAYSGNEHDVAPPCTFT
LCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFATLDLNRLRFWLGNDDNYTRYQLYLWFCEYLQ
GAELMAGGQSIPMPEFMLKAVGFESEDAMLPWPGNVHSGYRVLQEFFCYADSFLFFDACGIPALPDRLKE
NRFTLRLRFSRPLPADIRLRDDSLRLYCAPAINLFAHHAEAITLDHQRQDYALVPSRHFPDHYDIFSVNS
VVSQTQGKHRKADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHRTRTSLFHRGFDHTMAFIHAD
GSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNITRPTRPLWPVIDGSLHWSLL
SAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETTPVDRLFTGIPVRGLASTLSI
HPEPFVCEGEMYLLGAVLSHFLSLYASVNSFHMLTVVNTESQESWKWAERTGQHPLI
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c68159-66306 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGGAATTCGAAGAACGCTATTACAGGCAGGAGTTGGATCACCTGCGGCAGTTGAGCAAGCTGCTGGCGA
CCGAAAAGCCGCATCTGGCCCGGTTTCTGGCAGAAAAAGAGGCCGATCCGGATATCGAGCGTCTGCTGGA
GGGCGTGGCCTTTCTGACCGGCAATCTGCGCCAGAAAATTGAGGATGAGTTTCCGGAGCTGACGCACGGA
CTGATCCGGATGCTGTGGCCCAATTATCTGCGCCCGGTGCCGTCGATGACGCTGATTGAATATGCGCCGG
ATATGGATAAAACCTCCGTGCCGGTACTGATCCCCCGTAATGAGCAGTTCACAACCGGGGCGAAGGGGAC
TCAGGGAAACGCGGTATTGTCTGCGTATTCCGGCAATGAGCACGATGTAGCCCCGCCCTGTACGTTCACT
CTCTGCCGGGATATCTGGCTGTTACCCGTTCAACTGGATCAGGTTGAAAATCGCAGTACGCCCCGCCACG
GCATTATTGATATTACGTTTGCCGTCGCACCGGGCACTGATTTTGCCACGCTGGATCTGAACAGGCTGCG
CTTCTGGCTGGGCAACGATGATAACTATACCCGCTATCAGCTTTATCTGTGGTTTTGTGAATATTTACAG
GGCGCAGAGTTGATGGCGGGCGGGCAGTCGATCCCGATGCCTGAATTTATGCTGAAAGCGGTGGGTTTTG
AGTCAGAGGACGCCATGCTGCCCTGGCCCGGTAATGTCCACAGCGGCTACCGTGTTCTCCAGGAGTTTTT
CTGCTACGCCGACAGTTTTCTGTTTTTCGATGCCTGTGGCATTCCGGCATTGCCAGACAGGTTAAAGGAG
AACCGTTTCACCCTGCGGCTGCGGTTTTCACGCCCCTTACCGGCAGATATCCGGCTGCGGGATGATTCCC
TGCGCTTATATTGTGCGCCCGCCATTAATCTGTTTGCCCACCATGCCGAAGCCATCACGCTGGATCATCA
GCGGCAGGATTACGCTCTGGTTCCCAGCCGTCATTTTCCGGATCATTACGATATTTTTTCGGTTAACAGC
GTGGTGAGTCAGACACAGGGGAAGCACAGAAAAGCGGATCTTGGACGGCCAGTGATCACAGAGGCCGCGC
GCCACTGGCCTGCTTTTGAGAGTTTCCGCCACCAGATGGAGTACAGCCGCAAGCGGGAAGTGGTCTACTG
GCAGCACCGGACCAGGACCTCGCTGTTTCACCGGGGCTTTGATCATACCATGGCTTTTATTCATGCCGAT
GGCAGTCTCCCGGATGCCTCACTGCTTAATAATGAAGTGGTTTCGGTATCGCTGACCTGCACCAACCGGG
AGCTGCCGGTACAGCTACGGCCCGGCGATATCACCGGTACGACAGGTAAAAACGCGTCGGTGGCGTCATT
TCGCAATATCACCCGCCCCACCAGACCGCTCTGGCCGGTGATTGACGGCAGCCTGCACTGGTCGTTGCTG
TCTGCCATGAACCTGAATTATCTGTCGTTGCTGGATGCTGATGCGCTCAAACAGGTCATCGCCAATTTTG
ATCGCCACGCCATTCATCATCCGCAGATGGCCCGTCTGTCACAACAGAAGCTGGACGCCATTGAACGGCT
GGAAACTACGCCTGTTGATCGCCTGTTTACCGGCATACCGGTGCGCGGGCTGGCGTCCACCCTGTCCATT
CATCCGGAGCCGTTTGTCTGCGAGGGTGAAATGTACCTGCTGGGCGCGGTGCTGTCGCATTTTCTGTCGC
TGTACGCCAGCGTCAATTCGTTCCACATGCTGACCGTCGTTAATACGGAAAGCCAGGAGTCATGGAAATG
GGCGGAAAGAACCGGGCAACACCCGCTCATCTGA