SecReT6
Protein ID: 409249539
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1070
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]68164..68580 [-]
Producthypothetical protein
NoteTssE
UniProt IDE9A095
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-15, Aligned region: 32..115
Protein Sequence: 138 a.a.     [Download]
>gi|409249539|ref|YP_006885364.1| hypothetical protein SENTW_1070 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MIPARERPAGSLFERLENPPARNWREGSNIEAFRQSIRHSLRNILNTRSGSCRGTPGLGIEEPEGSDNYR
SAMSQAIVQCIERYEPRISHAEVRAILPQTASPQEIIFRITAWVTFNDIDDVLEFDMAPDGSQHYRVE
 
Nucleotide Sequence: 417 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c68580-68164 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
GTGATACCGGCGCGCGAAAGGCCTGCCGGATCGCTGTTTGAGCGTCTGGAAAACCCTCCTGCCAGAAACT
GGCGGGAGGGCAGTAATATAGAGGCGTTCAGGCAGTCCATTCGCCATAGTCTGCGCAATATCCTGAACAC
CCGTTCCGGCAGTTGTCGGGGAACGCCGGGGCTGGGTATTGAAGAGCCGGAAGGGTCGGATAATTACCGT
AGCGCCATGAGCCAGGCCATCGTGCAGTGTATTGAGCGTTATGAACCCCGGATTTCGCACGCGGAGGTCC
GGGCAATCCTGCCACAGACCGCCAGCCCACAGGAGATAATTTTTCGTATCACCGCCTGGGTGACATTTAA
CGATATCGACGATGTGCTGGAGTTTGATATGGCACCGGACGGTAGTCAGCATTATCGGGTGGAGTAG