SecReT6
Protein ID: 409249540
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1071
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]68577..70049 [-]
Producthypothetical protein
NoteTssC
UniProt IDE9A096
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-185, Aligned region: 68..489
Protein Sequence: 490 a.a.     [Download]
>gi|409249540|ref|YP_006885365.1| hypothetical protein SENTW_1071 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MSLQEEELVSTRTEQGSHAPSLLDEIMAQTRIQPGADGYDIARQGVTAFVASLLQSSSPAEPVNKLAVDS
MIADIDARISRQMDAIIHAPQFQQLESFWRSMKALVDRVDFRENIKVHVLHVTKAELLEDFEFAPEITQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTTPDMKLLNYVSAVGAMAHAPFLSSVSPEFMGLKSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSATENPIKSFNYAEDVSHSHEHYLWGNT
AWMLASNIADSFAKYRWAPNIIGPQSGGAVKDLPVHLYESMGQIQAKIPTEVLITDRREFELAEEGFITL
TMRKNSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNIWVRQYVADQENPPADVRSRKPLRGAKVEVLDVDGEPGWYQVAISARPHFKYMGASFELSLVGRLDK
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c70049-68577 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGTCTTTACAGGAAGAAGAACTTGTTTCCACCCGCACTGAACAGGGAAGCCATGCCCCGTCGTTGCTTG
ATGAAATCATGGCACAAACCCGTATCCAGCCCGGCGCTGACGGTTATGATATTGCCCGTCAGGGCGTAAC
AGCTTTTGTTGCCAGCCTCCTGCAATCCAGTTCACCTGCAGAACCCGTAAACAAACTGGCCGTGGACAGC
ATGATTGCGGACATCGACGCCCGTATCAGCCGTCAGATGGATGCTATTATTCACGCCCCTCAGTTTCAGC
AACTGGAGTCGTTCTGGCGTTCAATGAAAGCGCTGGTCGATCGCGTTGATTTTCGTGAGAATATTAAGGT
GCATGTCCTCCATGTCACCAAAGCGGAATTGCTGGAGGATTTCGAGTTCGCGCCGGAGATTACCCAGTCC
GGCTTCTATAAGCATGTTTATTCCAGCGGGTTTGGACAGTTTGGCGGCGAACCGATTGCGGCGGTGCTGG
GCGCATATGAGTTCAAAAATACCACGCCGGATATGAAGCTGCTGAACTATGTCAGCGCCGTCGGCGCAAT
GGCTCACGCGCCGTTCCTTTCTTCCGTGTCGCCGGAGTTTATGGGCCTGAAATCATGGACCGAGCTGCCC
AATATCAAGGATCTCTACGCTATTTTTGAAGGCCCGGCCTACACAAAATGGCGCGCCCTGCGTGATTCCG
AAGATTCCCGCTACCTGGGACTGACCGCGCCGCGTTTTCTGCTTCGCCAGCCCTATTCCGCGACCGAAAA
CCCGATTAAAAGCTTCAACTACGCCGAAGATGTGAGCCACAGCCACGAGCATTATTTGTGGGGCAATACC
GCCTGGATGCTGGCCAGTAATATAGCCGATTCGTTCGCGAAATACCGGTGGGCGCCCAATATTATCGGGC
CGCAGAGCGGCGGCGCAGTAAAAGATCTGCCGGTACATTTATATGAGTCAATGGGGCAGATTCAGGCCAA
GATCCCGACGGAGGTGTTGATCACCGACCGCCGTGAGTTCGAGCTGGCCGAAGAGGGGTTCATCACCCTG
ACCATGCGTAAAAACAGTGATAATGCGGCGTTTTTCTCGGCTAACAGCGTTCAGAAACCCAAGCATTTTC
CGGGCAAAGACGCCGAGACCAACTATAAGCTGGGTACGCAGTTGCCTTATCTGTTCATTATTAACCGTCT
CGCGCACTACATTAAGGTGCTGCAACGCGAGCAGCTCGGGTCGTGGAAAGAGAGAAGCGATCTGGAGCGG
GAGCTGAATATTTGGGTGCGCCAGTATGTCGCTGATCAGGAGAATCCGCCTGCTGATGTCCGCAGCCGTA
AGCCGCTGCGTGGCGCTAAAGTGGAGGTGCTGGATGTGGACGGCGAGCCGGGCTGGTATCAGGTGGCGAT
TTCCGCAAGGCCGCACTTTAAATATATGGGCGCGTCGTTTGAATTGTCTTTAGTCGGACGGTTAGATAAG
TGA