SecReT6
Protein ID: 409249541
SecReT6 ID768
T6SS typei1
Gene symbol-
Locus tagSENTW_1072
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]70340..70852 [-]
Producthypothetical protein
NoteTssB
UniProt IDE9A097
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.50E-54, Aligned region: 10..166
Protein Sequence: 170 a.a.     [Download]
>gi|409249541|ref|YP_006885366.1| hypothetical protein SENTW_1072 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MISMSKDYNGSVAPKERINISYIPKTDGEPSEVELPLNMLIVGDTGNSQETAPLDERQMVSIDKHSFNSV
MAEASISLNFAVPASLKDDAKDGDEMNISLEIKSLNDFSPDSVAKQVPELNKLLELREALTALKGPLGNL
PAFRAQLQALLENEESREQLLREISQAENQ
 
Nucleotide Sequence: 513 bp     [Download]
>gi|409249475|ref|NT_187088.1|:c70852-70340 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGATCTCTATGAGCAAAGATTATAACGGCAGCGTGGCACCCAAAGAACGCATTAATATTTCTTATATTC
CAAAAACGGACGGTGAGCCTTCTGAGGTGGAATTACCCCTTAATATGCTGATAGTGGGGGATACCGGAAA
CTCACAGGAAACAGCGCCACTTGATGAACGCCAGATGGTTTCTATCGACAAACATTCATTCAATTCAGTG
ATGGCAGAAGCGTCCATTAGCCTGAATTTTGCAGTTCCGGCATCATTGAAGGACGACGCAAAAGATGGCG
ATGAGATGAATATCTCGCTGGAAATCAAATCCCTGAACGATTTTTCTCCGGACAGTGTGGCAAAACAGGT
GCCGGAGTTGAACAAATTGCTGGAACTACGCGAAGCGCTGACAGCATTAAAAGGGCCGCTGGGTAATCTG
CCTGCATTTCGCGCCCAGCTTCAGGCATTGCTGGAAAATGAAGAATCCCGCGAACAGTTACTGCGGGAGA
TCAGCCAGGCAGAAAACCAGTAA