SecReT6
Protein ID: 409249544
SecReT6 ID768
T6SS typei1
Gene symbolvgrG
Locus tagSENTW_1075
StrainSalmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
Repliconchromosome [GenBank: NT_187088] [Browse all T6SS(s) in this replicon]
Location [Strand]72212..74353 [+]
ProductA-kinase anchor protein 5 A-kinase anchor protein 150 kDa; AKAP 150; P150; cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein
NoteTssI
UniProt IDE9A0A0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-64, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 1.50E-26, Aligned region: 366..458
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 500..522
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 524..545
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 548..570
Gp5_C [PF06715], Evalue: 0.0068, Aligned region: 614..632
Protein Sequence: 713 a.a.     [Download]
>gi|409249544|ref|YP_006885369.1| A-kinase anchor protein 5 A-kinase anchor protein 150 kDa; AKAP 150; P150; cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
MSTGLRFTLEVDGLPPDALVVESFHLSQSLSTLFSLDISLVSQQLHNIEFAQVLEKPAHLKIWQGTEIQR
RVNGIVTWFEQGENDGHQMLYSMKVRPPVWRAALRQNSRIFQNEDIKSILGTILQENGVTDWSPLFSEAH
PAREFCVQYSETDYDFLARMAAEEGIFFYEEHAQTSDDQSLVLCDTVRFLPEAFEIPWNPNTRTEVSTPC
VSQFRHSAQIRPSSVIGKDYTFKRPGWAGRFEHQGEHQDYQRTQYEVFDYPGRFKDGHGQNFTRWQMEGW
RNNAEVAQGKSRSPSIWPGRRIQLTEHPQTSLNREWQVVSSDLHGSQPQAAAGRSGSGTTLDNHFTVIPA
DRTWRPRPQPKPSVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPANQDSSCWIRVVQAWAGPGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRSPGSLPGTKTQMTIRSKTYKGSGFNELMFDDATGK
ERVYIHAQKNMNTEVLHNRTTDVTNNHAETIGNNQVIAVTNNQIQTIGVNQIQNVSVNQVEKVGSNQVIK
VGTNQIETVGLLRALNVGVVYQTTVGAIMNTSVAMMQSSQVGLHKSLMVGMGYSVNVGNKVTFSVGKTRS
DNAGQTAIYSAGEHLELRCGKARLVMTKDGKIFLNGTKIDLEGAESVNGDALTINWNCGATETVPDAPKD
DSPEPKMPDMRKF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|409249475|ref|NT_187088.1|:72212-74353 Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
ATGTCAACAGGATTACGTTTCACACTGGAGGTGGACGGCCTGCCACCGGATGCGCTGGTCGTGGAGTCCT
TTCACCTGAGCCAGTCCCTTTCCACGTTATTTTCCCTCGATATCTCGCTGGTCAGCCAGCAACTTCACAA
CATTGAGTTTGCCCAGGTACTGGAAAAACCGGCGCACCTGAAAATCTGGCAGGGCACGGAGATACAGCGC
CGGGTGAACGGCATAGTGACCTGGTTTGAGCAGGGGGAAAACGACGGACACCAGATGCTGTACAGCATGA
AAGTTCGCCCGCCGGTGTGGCGCGCCGCGCTGCGGCAGAACTCGCGTATTTTCCAGAATGAAGACATAAA
AAGCATTCTCGGGACGATACTGCAGGAAAACGGCGTGACGGACTGGAGCCCGCTGTTCAGTGAGGCGCAT
CCGGCGCGGGAGTTCTGCGTGCAGTACAGCGAAACGGATTACGACTTTCTGGCGCGGATGGCGGCGGAGG
AAGGTATTTTCTTTTACGAGGAACATGCGCAGACCAGCGACGACCAGAGCCTGGTGCTGTGCGACACGGT
ACGTTTTCTGCCGGAAGCCTTTGAAATCCCCTGGAACCCGAACACCCGTACCGAGGTGAGCACGCCGTGC
GTCAGCCAGTTCCGCCACAGCGCACAAATCCGCCCCTCCTCCGTCATCGGCAAGGACTACACCTTCAAAC
GCCCCGGCTGGGCAGGCCGCTTTGAGCATCAGGGTGAACATCAGGATTACCAGCGCACGCAGTACGAGGT
GTTTGACTATCCGGGGCGCTTCAAGGACGGCCACGGTCAGAACTTCACCCGCTGGCAGATGGAGGGCTGG
CGTAATAATGCCGAAGTGGCGCAGGGGAAAAGCCGTTCTCCGTCGATATGGCCGGGACGGCGTATTCAGC
TGACGGAACATCCGCAGACGAGCCTGAACCGGGAATGGCAGGTGGTGAGCAGTGATTTACACGGCAGCCA
GCCGCAGGCGGCGGCGGGGCGCTCAGGCTCAGGGACAACGCTGGATAATCATTTTACGGTCATCCCGGCA
GACAGAACATGGCGGCCACGCCCGCAGCCCAAACCGTCAGTGGACGGCCCGCAGTCGGCAGTGGTCACCG
GCCCGGAAGGGGAAGAAATCTTCTGCGACGAACATGGACGGGTGCGGGTGAAATTTAACTGGGACCGGTA
TAACCCGGCGAACCAGGACAGCTCGTGCTGGATACGGGTGGTACAGGCGTGGGCGGGGCCGGGATTCGGC
AACCTGGCGATACCGCGCGTGGGGCAGGAAGTGATAGTGGACTTCCTGAATGGCGACCCGGACCAGCCCA
TTATTATGGGGCGCACCTACCACCAGGAAAACCGCTCGCCGGGCAGCCTGCCGGGCACCAAAACGCAGAT
GACCATCCGCTCGAAAACCTATAAAGGCAGCGGGTTTAACGAACTCATGTTTGATGATGCGACAGGGAAG
GAGCGGGTGTATATCCACGCGCAGAAGAACATGAATACCGAGGTGCTGCACAACCGCACCACCGATGTGA
CGAATAACCATGCTGAAACCATTGGTAATAACCAGGTGATCGCTGTCACCAATAACCAGATACAGACCAT
CGGCGTCAACCAGATCCAGAACGTTAGCGTCAACCAGGTGGAGAAAGTGGGCAGCAATCAGGTGATCAAG
GTGGGGACAAACCAGATTGAAACGGTGGGACTCCTCCGCGCCCTGAATGTGGGCGTGGTGTACCAGACTA
CGGTGGGCGCCATTATGAACACCTCAGTGGCCATGATGCAGTCTTCACAGGTGGGCCTGCATAAATCGCT
GATGGTGGGGATGGGGTACAGCGTTAATGTGGGGAACAAAGTCACCTTCTCGGTGGGGAAAACAAGGTCA
GACAATGCCGGGCAGACAGCGATTTATTCTGCGGGTGAACATCTGGAGCTTCGCTGCGGTAAAGCCCGGC
TGGTAATGACGAAGGACGGAAAAATTTTCCTTAACGGAACGAAAATTGATCTGGAAGGTGCGGAAAGCGT
CAATGGTGATGCGCTGACGATCAACTGGAACTGCGGCGCAACAGAAACCGTGCCGGATGCGCCGAAGGAT
GACTCGCCGGAGCCGAAGATGCCGGATATGAGGAAGTTCTGA