SecReT6
Protein ID: 409910979
SecReT6 ID602
T6SS typeN/A
Gene symboltssJ
Locus tagKN400_0397
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]422979..423533 [+]
Producttype VI secretion system outer membrane lipoprotein TssJ
NoteTssJ
UniProt IDD7AEH6
KEGG IDgsk:KN400_0397
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.00E-27, Aligned region: 15..172
Protein Sequence: 184 a.a.     [Download]
>gi|409910979|ref|YP_006889444.1| type VI secretion system outer membrane lipoprotein TssJ [Geobacter sulfurreducens KN400]
MKRHSALLPCWSVVACLCSCASSPEVRPPVEWGFEREAIHLSLTGDPRLNLYQNSPHALVACIYQLRDPN
AFNQLRNEPDGPARLLECSRFDQAVATARRVVIQPGQVLNDVLDRAEGARYVGFAAGYYLLDKERSVRLY
PIPISEETKGFVSRTKLVKPGRVDIRLHLGPQEIQDVKEEPRKP
 
Nucleotide Sequence: 555 bp     [Download]
>gi|385795588|ref|NC_017454.1|:422979-423533 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGAAGCGTCATTCCGCTTTGTTGCCGTGTTGGTCTGTCGTTGCGTGCCTCTGCTCCTGTGCCTCGTCTC
CGGAGGTCAGGCCGCCGGTTGAGTGGGGGTTCGAAAGGGAGGCCATTCATCTGAGCCTCACCGGCGACCC
CCGGCTGAATCTCTATCAGAACAGCCCCCACGCACTTGTTGCCTGCATCTACCAACTTCGCGATCCGAAC
GCCTTCAACCAGTTGCGGAACGAACCGGACGGGCCGGCAAGGCTGCTGGAATGCAGCAGGTTCGACCAAG
CCGTGGCAACGGCCAGGCGGGTTGTCATCCAGCCAGGTCAGGTATTGAACGACGTCCTGGATCGGGCCGA
GGGGGCACGCTACGTGGGTTTTGCGGCGGGATACTACCTGCTCGACAAGGAACGGTCGGTCCGGCTCTAC
CCGATCCCGATCAGTGAGGAGACGAAGGGATTCGTCAGCCGCACGAAGCTCGTCAAGCCGGGACGGGTCG
ATATTCGGCTGCATCTGGGCCCTCAGGAGATTCAGGATGTGAAGGAGGAGCCCCGAAAGCCATGA