SecReT6
Protein ID: 409910980
SecReT6 ID602
T6SS typeN/A
Gene symboltssK
Locus tagKN400_0398
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]423530..424921 [+]
Producttype VI secretion system protein TssK
NoteTssK
UniProt IDD7AEH7
KEGG IDgsk:KN400_0398
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-102, Aligned region: 19..460
Protein Sequence: 463 a.a.     [Download]
>gi|409910980|ref|YP_006889445.1| type VI secretion system protein TssK [Geobacter sulfurreducens KN400]
MNAHPPLYWHQGLFLQPHHFQLQDLSVQGRLAPLFRHLHPHFWGAGELEIEASALGTRVFSILSGEFLFP
DGTWAVIGENALCEPRSFDDSWIEGDRPLPVYVGVRKWSGDRENVTVTERLENLGGITTRFAAAADPEEM
RDLHAGGPAGQVKRLRHVLKILWDSERDQLGDWHLIPVARLERFGADVRLSGRFIPPCLSLEASEPLFRI
VREIRDQVAARARQLEEHKKQRGIQNAGFGSRDMVYLLALRSLNRHVPLLFHLTEARQVHPWDVYGALRQ
LIGELSSFSERVSALGKLDDGVRLLPPYDHRALGERFFVARDLIARLLDEITAGPDYVIRLTHDGTFFSA
DLKPGIFETGSRYYLALRTTTEPAAFLPSLEAAAKLSARNHLPVLAARALPGIGLSHLPVPPQELPRRAD
THYFAVDTAGDQWPLVEREHALALHWTGAPADLEVELMVVAKG
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|385795588|ref|NC_017454.1|:423530-424921 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGAACGCCCATCCCCCCCTTTACTGGCACCAGGGGCTCTTTCTCCAGCCCCATCACTTTCAGCTCCAGG
ACCTGTCGGTCCAGGGGCGTCTCGCCCCCCTGTTCCGCCATCTCCACCCCCACTTCTGGGGGGCGGGTGA
GCTGGAGATCGAGGCCAGCGCTCTCGGCACCCGGGTCTTCAGCATCCTTTCCGGCGAGTTCCTTTTCCCC
GACGGCACCTGGGCGGTCATCGGCGAGAACGCCCTCTGCGAGCCGCGCTCCTTCGACGACTCCTGGATCG
AAGGGGATCGTCCCCTGCCGGTCTACGTGGGAGTGCGCAAGTGGAGCGGGGATAGAGAGAACGTGACCGT
CACCGAACGGCTCGAAAACCTCGGCGGGATCACCACCCGCTTCGCCGCCGCGGCAGATCCGGAGGAGATG
CGCGATCTCCACGCCGGCGGCCCGGCAGGTCAGGTGAAGCGGCTGCGCCATGTGCTGAAAATCCTCTGGG
ACAGCGAGCGGGACCAACTGGGCGACTGGCACCTGATCCCGGTGGCGCGGCTGGAGCGCTTCGGGGCCGA
CGTGCGGCTCTCCGGCCGCTTCATCCCCCCTTGCCTCTCCCTCGAAGCGAGCGAGCCCCTCTTTCGCATC
GTCCGGGAGATCCGGGACCAGGTGGCGGCCCGCGCCAGACAGCTGGAGGAGCACAAGAAGCAGCGCGGCA
TCCAGAACGCCGGGTTCGGCTCTCGGGACATGGTCTACCTCCTGGCGCTCCGTTCTCTCAACCGGCATGT
GCCTCTCCTCTTCCACCTGACCGAGGCGCGGCAGGTCCACCCGTGGGACGTCTACGGGGCCCTGCGCCAG
CTCATCGGCGAACTCTCCTCCTTCTCCGAGCGGGTCTCGGCCCTTGGCAAACTGGACGACGGCGTCCGGC
TTCTCCCTCCCTATGATCACCGGGCACTCGGGGAGCGCTTTTTCGTGGCCCGTGACCTCATCGCCCGACT
TCTGGACGAGATCACCGCCGGTCCCGATTACGTGATCCGCCTCACCCACGACGGCACCTTCTTCAGCGCC
GACCTGAAGCCGGGCATCTTTGAAACCGGCAGCCGCTATTACCTGGCCCTGCGGACCACCACGGAGCCGG
CTGCGTTCCTCCCGTCCCTTGAAGCCGCCGCCAAGCTCAGCGCCCGGAACCACCTGCCGGTCCTGGCCGC
CCGCGCCCTCCCCGGCATCGGCCTGAGCCACCTGCCGGTCCCGCCCCAGGAGCTGCCGCGCCGCGCCGAC
ACCCACTACTTCGCCGTTGATACTGCCGGTGACCAATGGCCCCTGGTGGAGCGGGAACACGCCCTTGCCC
TCCACTGGACCGGCGCCCCGGCCGATCTGGAGGTGGAGCTGATGGTGGTGGCCAAGGGGTAG