SecReT6
Protein ID: 409910981
SecReT6 ID602
T6SS typeN/A
Gene symboltssE
Locus tagKN400_0399
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]424925..425332 [+]
Producttype VI secretion system needle hub protein TssE
NoteTssE
UniProt IDD7AEH8
KEGG IDgsk:KN400_0399
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-20, Aligned region: 27..115
Protein Sequence: 135 a.a.     [Download]
>gi|409910981|ref|YP_006889446.1| type VI secretion system needle hub protein TssE [Geobacter sulfurreducens KN400]
MREERLLERIRSLERDPSRRGGTDRGRLVDSILAHVRRIINTRRGSVPIAPDFGIPDMLDVLQSYPDSVR
EIERSIRAAIQGFEPRLADVRVAFVPQEDDVLALRFAISARLGSDGGAVCFETLVDTDGKVTVRR
 
Nucleotide Sequence: 408 bp     [Download]
>gi|385795588|ref|NC_017454.1|:424925-425332 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGCGCGAAGAACGCCTTCTGGAACGTATCCGCTCCCTGGAGCGGGATCCGTCGCGCCGCGGGGGGACTG
ATCGGGGCCGTCTGGTGGATTCAATCCTGGCACACGTCCGCCGGATTATTAACACGCGCCGGGGGAGCGT
GCCTATCGCCCCTGACTTCGGCATCCCTGACATGCTCGACGTGCTTCAGAGCTACCCAGATTCGGTGCGG
GAGATCGAACGGAGCATCCGTGCCGCCATCCAGGGCTTTGAGCCGCGTCTCGCCGACGTAAGGGTTGCCT
TCGTCCCGCAGGAGGACGACGTGCTGGCGCTCCGGTTTGCCATCTCCGCCCGGCTTGGCAGCGACGGCGG
AGCGGTCTGTTTTGAAACGCTGGTGGATACCGACGGGAAGGTTACGGTGAGACGTTGA