SecReT6
Protein ID: 409910982
SecReT6 ID602
T6SS typeN/A
Gene symboltssF
Locus tagKN400_0400
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]425361..427094 [+]
Producttype VI secretion system protein TssF
NoteTssF
UniProt IDD7AEH9
KEGG IDgsk:KN400_0400
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-180, Aligned region: 3..577
Protein Sequence: 577 a.a.     [Download]
>gi|409910982|ref|YP_006889447.1| type VI secretion system protein TssF [Geobacter sulfurreducens KN400]
MITRHFQDELARLKELGAEFSVTHPALAPMLGGPSTDPDVERLLEGVAFQTALLRQKLDDDFPEVVHDLV
RLVAPHYLRPVPATTIVAFEPKPSLTRSRLIPAGTELASIPVEGTRCLFRTTSPVELHPLELLEATFAQP
AGSAPVVTLSLSLTGLSLDHWEPRSLRFFLAGDHAPAAELFLILSRHLKRIVITPEERGASASLPAACLQ
PVGLNDDEHLIPWPSHAFPGYRLLQEYFAAPQRFLFLELTGWERWTTRGSGSRFTITFELGELTIPPPPV
RRDSFVLFASPAVNLFSHDAEPILLDHRVGRYPVRPAGLEPGHGQVYSVDRVTGIVRGAATERIYHPFEQ
FRDGADAQPTFHTAVSASPVRAGFDVHLAVAYPQGEGLPETETLSIALTCSNGRLPENLWLGDLCEPTSS
SPESATFHNITPLTPTLLPPLGKNLLWRLVSHLSLNRLSLASADNLRTLLALYLFEEGGDRGDLAANRKR
LDGIEAVIAKPAGRLVGGHLLRGSEIVLTLRGDHFASPGDLFLFGAVLDRFLGGYASLNSFTRLTVRESV
RGEVYSWAPRLGHRQLL
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|385795588|ref|NC_017454.1|:425361-427094 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGATCACCCGTCATTTTCAGGATGAACTCGCCCGACTCAAGGAGTTGGGGGCCGAGTTCTCCGTGACCC
ACCCGGCGTTGGCGCCGATGCTCGGCGGTCCGTCGACCGACCCGGATGTGGAGCGGCTCCTGGAGGGCGT
TGCCTTCCAGACGGCTCTCCTTCGCCAAAAACTCGATGATGATTTCCCCGAAGTGGTCCACGATCTGGTT
CGTCTTGTGGCCCCCCACTACCTGCGGCCGGTGCCGGCCACCACCATCGTCGCCTTCGAACCGAAGCCGT
CACTGACTCGCTCACGGCTGATTCCGGCCGGGACCGAGCTTGCGTCGATCCCGGTGGAGGGAACCCGCTG
CCTCTTCCGGACAACGAGCCCGGTAGAACTTCATCCTCTGGAACTTCTCGAGGCAACGTTTGCCCAACCA
GCAGGGAGCGCTCCAGTCGTAACCCTGTCCCTGTCGCTCACTGGCCTCTCGCTCGACCACTGGGAGCCAC
GATCGCTGCGATTTTTTCTGGCCGGCGACCATGCCCCGGCAGCGGAGCTGTTCCTGATCCTCTCCCGGCA
CCTGAAGCGAATCGTGATCACCCCGGAGGAGAGAGGGGCGTCGGCCAGCCTGCCCGCAGCCTGTCTTCAG
CCGGTGGGCCTCAATGACGACGAGCACCTGATTCCCTGGCCATCCCACGCCTTTCCCGGCTATCGGCTGT
TGCAGGAATATTTTGCCGCGCCCCAACGGTTCCTGTTCCTGGAGTTGACCGGCTGGGAACGCTGGACCAC
CCGTGGCAGCGGCTCGAGATTCACCATTACCTTCGAGTTAGGCGAACTCACTATCCCTCCGCCCCCGGTG
CGGCGGGATAGCTTTGTTCTTTTCGCCTCCCCGGCCGTGAACCTCTTTTCACACGACGCCGAACCGATTC
TCCTCGACCACCGGGTCGGGAGATACCCGGTGAGGCCTGCGGGTCTGGAACCGGGGCACGGTCAGGTATA
TTCCGTCGATCGTGTGACCGGTATCGTCCGGGGGGCGGCAACGGAGCGCATCTATCACCCCTTCGAGCAG
TTCAGGGATGGCGCAGATGCCCAGCCAACCTTTCATACCGCCGTATCCGCTTCGCCGGTCCGCGCCGGAT
TCGATGTGCACCTGGCCGTTGCCTACCCACAGGGGGAGGGGTTGCCGGAGACGGAGACGCTTTCCATCGC
TCTTACCTGCAGCAACGGCCGCCTGCCGGAAAATCTGTGGCTCGGCGACCTGTGCGAACCGACCTCCTCC
TCACCCGAGAGTGCCACCTTCCACAACATCACGCCACTTACCCCGACGCTGCTGCCGCCACTGGGGAAAA
ATCTCCTCTGGCGACTCGTTTCCCATCTGTCCCTTAACCGCCTCTCCCTGGCCAGCGCCGACAATCTCCG
CACTCTCCTGGCGCTCTACCTGTTCGAGGAGGGAGGGGACCGGGGTGACTTGGCCGCCAACCGGAAGCGG
CTGGACGGGATCGAAGCGGTTATCGCCAAGCCGGCCGGCCGCCTCGTGGGGGGGCACCTACTGCGGGGCA
GCGAGATTGTCCTTACTCTGCGGGGGGACCACTTTGCCAGCCCGGGCGATCTGTTCCTCTTCGGGGCGGT
GCTCGACCGCTTTCTGGGGGGCTATGCCTCGCTCAACAGCTTCACCCGCCTGACCGTCCGCGAAAGCGTT
CGGGGAGAGGTGTACTCATGGGCTCCCCGCCTTGGTCACCGCCAGCTTCTCTAG