SecReT6
Protein ID: 409910983
SecReT6 ID602
T6SS typeN/A
Gene symboltssG
Locus tagKN400_0401
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]427058..428050 [+]
Producttype VI secretion system protein TssG
NoteTssG
UniProt IDD7AEI0
KEGG IDgsk:KN400_0401
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-77, Aligned region: 20..313
Protein Sequence: 330 a.a.     [Download]
>gi|409910983|ref|YP_006889448.1| type VI secretion system protein TssG [Geobacter sulfurreducens KN400]
MGSPPWSPPASLETQLFERGHEFSFAQAVRLLRLLAAAQGREGACPCGVRVRPELSLSFPVADVARIERQ
SDGYRITARFLGLYGPSSPLPTFYTEELIDEEREDGSASRDFLDVLSHRIFDLWVAGDAKYRLFNRVVED
GSGDDLERLFCLAGLDLAQGQTVLPESGRWLRYVGLLGQVPRSALGLRTMVADALGVPVEVIPCQHRQVS
IPPGQRLAVGIAASSLGIDTVVGTNLDDRLGMFRLCLGPLSREQFADLLPGAPGRSTLDLIVELYLDAPL
AWDVELTLAPGETPEARLGACRGARVGWDTWLGVAAGESLPCVVFPGHFP
 
Nucleotide Sequence: 993 bp     [Download]
>gi|385795588|ref|NC_017454.1|:427058-428050 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGGGCTCCCCGCCTTGGTCACCGCCAGCTTCTCTAGAGACGCAGCTGTTCGAGCGGGGGCATGAGTTCT
CCTTTGCCCAGGCGGTGCGCCTGCTGCGGCTTCTTGCGGCCGCTCAGGGGAGGGAGGGCGCTTGCCCGTG
CGGGGTACGGGTCCGGCCCGAGCTTTCCCTCTCCTTTCCGGTTGCTGATGTGGCGCGGATCGAGCGGCAG
AGCGACGGCTACCGGATAACGGCCCGCTTCCTCGGTCTCTACGGCCCGTCATCTCCCCTGCCAACCTTCT
ACACCGAAGAACTGATAGACGAGGAGCGGGAAGACGGCTCTGCTTCACGGGATTTTCTCGACGTGCTGAG
CCACCGGATCTTTGATCTCTGGGTCGCCGGCGACGCCAAGTATCGCCTGTTCAACCGGGTTGTGGAGGAC
GGAAGCGGGGATGACCTCGAACGTCTTTTTTGTTTGGCTGGGCTCGACCTGGCCCAGGGGCAGACAGTCC
TGCCGGAGTCCGGCCGCTGGCTCCGCTATGTGGGTCTCCTGGGACAGGTTCCCCGCTCTGCCCTGGGGTT
GCGGACCATGGTCGCCGACGCCCTCGGCGTACCGGTTGAAGTCATCCCCTGCCAGCACCGGCAGGTGTCG
ATTCCCCCCGGACAGCGGCTAGCCGTGGGCATAGCCGCGAGCAGTCTCGGCATCGACACGGTCGTCGGAA
CCAATCTGGATGACCGGCTGGGCATGTTCCGCCTGTGCCTGGGGCCCCTTTCCCGCGAACAGTTCGCGGA
TCTCCTCCCCGGCGCCCCTGGCCGCTCGACTCTGGACCTGATCGTGGAACTCTACCTGGATGCCCCCCTC
GCCTGGGACGTGGAGTTGACCCTGGCCCCGGGAGAGACGCCGGAAGCACGTCTCGGCGCTTGTCGGGGGG
CACGGGTCGGATGGGACACCTGGCTTGGTGTCGCAGCCGGCGAATCCCTGCCTTGCGTTGTATTTCCCGG
ACATTTTCCCTAA