SecReT6
Protein ID: 409913607
SecReT6 ID603
T6SS typei1
Gene symboltssL
Locus tagKN400_3104
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]3363993..3364676 [+]
Producttype VI secretion system inner membrane protein TssL
NoteTssL
UniProt IDD7AEV7
KEGG IDgsk:KN400_3104
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.20E-43, Aligned region: 1..214
Protein Sequence: 227 a.a.     [Download]
>gi|409913607|ref|YP_006892072.1| type VI secretion system inner membrane protein TssL [Geobacter sulfurreducens KN400]
MHLTDCFTDVMAYLNHSLRTIGVRQPPYGEIRCEIERFMATADAAARSEGLDGEEFDLARFAVCAWIDEA
ILSSSWEEKNTWLKEQLQRIHYATTDAGEEFFTRLTALGLNQREVREVFYLCLAFGFTGKYCKPGDEYHL
EQLKTAQLKLLMGSSVGLPSLERTELFPEAWPSGPAPATVRPGRGQGSRAFLVAVAAVPVALFLILLLAY
RFTLTGVGDTFLRTVPY
 
Nucleotide Sequence: 684 bp     [Download]
>gi|385795588|ref|NC_017454.1|:3363993-3364676 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGCATCTGACCGACTGCTTCACAGACGTTATGGCCTACCTGAACCACTCCCTCCGGACCATCGGGGTCC
GACAGCCCCCCTACGGAGAAATTCGCTGTGAAATCGAACGGTTCATGGCGACGGCGGATGCCGCAGCCCG
CAGCGAAGGGCTCGACGGGGAGGAATTCGACCTGGCGCGCTTCGCCGTCTGCGCCTGGATCGACGAAGCG
ATTCTCTCCTCATCATGGGAAGAAAAAAACACCTGGCTGAAGGAACAACTCCAGCGCATCCACTACGCCA
CCACCGACGCGGGGGAGGAATTCTTCACCAGGCTCACGGCGCTCGGGCTCAATCAGCGGGAGGTGCGGGA
AGTGTTCTATCTCTGCCTGGCCTTCGGCTTTACCGGCAAATACTGCAAGCCTGGCGACGAGTACCACCTG
GAACAGTTGAAAACCGCCCAGCTGAAACTGCTGATGGGAAGTTCGGTAGGACTTCCCTCTCTGGAACGGA
CCGAACTCTTTCCCGAGGCATGGCCGTCGGGGCCGGCACCGGCAACCGTCCGCCCCGGACGCGGGCAGGG
AAGCCGGGCGTTCCTGGTTGCCGTGGCAGCTGTGCCGGTGGCCTTGTTCCTGATTCTGCTCCTGGCCTAC
CGCTTCACGCTCACGGGCGTGGGTGACACGTTCCTGAGGACGGTACCATACTGA