SecReT6
Protein ID: 409913609
SecReT6 ID603
T6SS typei1
Gene symbol-
Locus tagKN400_3106
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]3368189..3370558 [+]
Producttype VI secretion system protein
NoteTssA
UniProt IDD7AEV9
KEGG IDgsk:KN400_3106
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.10E-19, Aligned region: 313..373
DUF2094 [PF09867], Evalue: 2.40E-10, Aligned region: 12..101
DUF2094 [PF09867], Evalue: 2.40E-10, Aligned region: 410..438
DUF2094 [PF09867], Evalue: 2.40E-10, Aligned region: 696..729
Protein Sequence: 789 a.a.     [Download]
>gi|409913609|ref|YP_006892074.1| type VI secretion system protein [Geobacter sulfurreducens KN400]
MPSVDPCWRWSAFGKHPAAADYFRLGEDSPFVEGLAAWVENGYRHLISRHEATMPFCSWRFWARGFGRDS
LVLGVVRLSSDSLGRSYPLLIMGSGPLEGWEEQWDLLPFACEPSWCQIEYLATHSFDGLKHVGEGLRRVR
PPGSDWDELAERRRGLNRLGSPLDPYASFLDIPSLERLVAEHSGREEFSVRLDRGPVHDKITLVSLWHFL
TKRTVKGVPHTLFMGGNLEHSFLASFRRALTPGDFLHLWSAPEAGGWHDSIGTGHALDIASIGKEPVCPE
RPAGEDIRYDPLFDALQAEVDKLTSPAVAGAVDWERVVHMAADILATRSKDLLVASYLAVGLVQTRGGDG
LALGLTVWRDLLERFWCTLYPTRTRGRQRSVEWWLDRTVIALHHQGNWSLPPEQHGIVLETLGAIDRFLG
ERLEDAPSLTKLWQLLADMAPEGGEETAPEAVVATPAQAEAPATGLFAPPRQTAAPAVEPPCQAIATGSS
LQMLEEALRQVGEAAGALIQQDPAAPVSYRLSRLAAWGKVTELPPSINGRTRIPPPERQVLTLLQELASH
GDGEALLKAAEARLPQFIFWLDLSRLTAKALCRLGDRFAAAREAVCAETAAFVGRLPALPDLTFADGTPF
AAPETRQWLTGLAQRGASVADCPAVGHNDGRAAAIAREVEEAQALIRDGKLLEAVERFQKQLGNGASRKE
RLHWRLALAQLLVNTNRAKLALPHLEQVVADIEAFGLEEYDPALALRGLKLAWAGFDSQIEPRFKEKAAD
ALHRIARLDPVEMVRLTKG
 
Nucleotide Sequence: 2370 bp     [Download]
>gi|385795588|ref|NC_017454.1|:3368189-3370558 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGCCCTCCGTTGATCCGTGCTGGCGCTGGTCTGCCTTCGGCAAACATCCTGCCGCAGCTGACTATTTTC
GGCTCGGTGAGGATTCTCCCTTTGTCGAAGGATTGGCCGCATGGGTGGAGAACGGGTACCGGCATCTCAT
CAGTCGGCACGAAGCGACAATGCCGTTCTGCTCCTGGCGCTTCTGGGCCCGCGGGTTCGGCCGGGATTCC
CTTGTCCTTGGAGTGGTCCGGCTCTCCAGCGACAGCCTCGGCCGCTCCTATCCGCTGCTCATCATGGGAA
GCGGCCCCCTTGAGGGATGGGAAGAGCAGTGGGACCTGCTCCCTTTTGCTTGTGAACCGTCATGGTGCCA
GATCGAGTACTTGGCGACGCATTCCTTTGATGGTCTGAAGCACGTGGGTGAAGGACTCCGAAGGGTTCGC
CCCCCCGGGTCGGACTGGGACGAGCTGGCGGAACGGCGCCGCGGCCTGAACCGGCTCGGTTCCCCCCTTG
ATCCCTATGCATCCTTCCTGGACATCCCCAGTCTCGAACGACTGGTCGCCGAACATTCCGGCCGGGAAGA
GTTTTCCGTCAGACTCGACCGGGGGCCGGTGCATGACAAAATCACCCTGGTAAGCCTTTGGCACTTCCTG
ACCAAGAGGACCGTCAAAGGAGTCCCCCACACCCTTTTCATGGGCGGCAACCTGGAACACTCCTTTCTCG
CCTCCTTCCGGCGGGCCCTGACCCCGGGGGATTTTCTCCACCTCTGGTCCGCGCCGGAGGCAGGAGGATG
GCACGACAGCATCGGAACGGGGCACGCCTTGGACATTGCATCTATCGGAAAAGAACCGGTGTGCCCCGAA
CGGCCGGCCGGCGAGGATATTCGCTACGATCCCCTCTTCGACGCGCTCCAGGCGGAGGTTGACAAGCTCA
CCTCCCCCGCCGTGGCCGGTGCCGTCGACTGGGAACGGGTGGTACATATGGCAGCCGACATCCTCGCCAC
CCGGTCCAAAGACCTCCTTGTGGCGAGCTACCTGGCAGTGGGACTCGTCCAGACCCGCGGGGGTGACGGC
CTCGCTCTGGGGCTCACTGTCTGGCGCGATCTCCTGGAACGGTTCTGGTGCACCCTCTACCCCACCCGCA
CACGGGGGCGCCAACGATCGGTGGAGTGGTGGCTGGATCGGACCGTGATCGCCCTGCATCATCAGGGAAA
CTGGTCCCTTCCCCCCGAGCAACACGGCATTGTGCTGGAAACCCTTGGCGCCATAGACCGCTTTCTGGGA
GAGCGCCTGGAGGATGCCCCGTCCCTTACGAAACTGTGGCAACTACTGGCGGACATGGCGCCGGAAGGCG
GAGAAGAAACGGCCCCCGAAGCCGTGGTTGCTACGCCGGCTCAAGCCGAGGCTCCCGCCACTGGCCTATT
CGCTCCGCCCCGTCAAACCGCCGCCCCCGCCGTGGAGCCCCCCTGTCAGGCGATTGCCACTGGCTCCTCC
CTTCAGATGCTGGAGGAAGCGCTTCGCCAGGTGGGGGAGGCGGCCGGCGCCCTCATCCAGCAGGATCCCG
CGGCCCCCGTATCCTATCGGCTCTCCCGCCTTGCCGCCTGGGGGAAGGTAACCGAGCTCCCGCCGTCGAT
AAACGGACGTACCCGAATCCCTCCTCCCGAGCGGCAGGTGCTGACCCTTCTCCAGGAACTGGCCAGCCAC
GGAGACGGCGAGGCGCTCCTGAAGGCGGCTGAGGCGCGGCTTCCCCAGTTCATCTTCTGGCTCGATCTGA
GCCGGCTCACCGCCAAGGCTCTCTGCCGCCTCGGCGACCGCTTTGCCGCCGCCCGCGAAGCGGTCTGCGC
GGAGACGGCCGCCTTTGTGGGTCGGCTTCCGGCCCTTCCTGACCTGACCTTTGCCGACGGCACTCCCTTT
GCCGCCCCGGAAACCCGCCAGTGGCTCACGGGGCTCGCACAGCGCGGGGCATCCGTTGCAGACTGCCCTG
CGGTGGGTCATAACGACGGCCGCGCCGCGGCCATTGCCCGGGAGGTGGAAGAGGCCCAGGCTCTCATTCG
GGACGGCAAACTCCTGGAGGCGGTGGAGCGGTTCCAGAAACAACTCGGCAACGGCGCCTCCCGCAAGGAG
AGGCTCCACTGGCGTCTCGCCCTGGCCCAACTCCTTGTGAACACCAATCGGGCCAAGCTGGCACTCCCCC
ATCTAGAGCAGGTCGTGGCGGACATCGAGGCCTTCGGCCTCGAAGAGTACGACCCGGCCCTGGCCCTGCG
GGGGCTGAAGCTCGCCTGGGCCGGCTTCGATTCCCAGATCGAGCCCCGCTTCAAGGAAAAGGCCGCCGAT
GCCCTCCACCGGATCGCCCGCCTCGATCCGGTGGAGATGGTGCGACTGACGAAGGGGTAG