SecReT6
Protein ID: 409913614
SecReT6 ID603
T6SS typei1
Gene symboltssB
Locus tagKN400_3111
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]3375185..3375670 [+]
Producttype VI secretion system needle sheath protein TssB
NoteTssB
UniProt IDD7AEW4
KEGG IDgsk:KN400_3111
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-53, Aligned region: 5..158
Protein Sequence: 161 a.a.     [Download]
>gi|409913614|ref|YP_006892079.1| type VI secretion system needle sheath protein TssB [Geobacter sulfurreducens KN400]
MSNEASVAPKERVNIVYRPADGEGREEVELPLKILVLGDFTGQPDERPVEKRDPVPVDKENFSEVMKAQR
IMLNIAVSNRLYDAPDEELPVKLKMESLRDFGPEAIVEQVPEMKRLLELREALRALKAPLSNIPDFRRKI
QELVTDDAARAKLLAEIGIEG
 
Nucleotide Sequence: 486 bp     [Download]
>gi|385795588|ref|NC_017454.1|:3375185-3375670 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGTCGAATGAAGCATCCGTAGCACCGAAGGAACGGGTGAACATCGTCTACCGTCCCGCCGATGGCGAAG
GGCGCGAGGAAGTGGAGCTTCCCCTTAAAATCCTGGTGTTAGGGGACTTTACCGGGCAACCGGACGAGCG
GCCCGTGGAGAAGCGGGACCCGGTGCCAGTGGACAAAGAAAACTTCAGCGAGGTCATGAAGGCCCAGAGA
ATCATGCTGAACATCGCCGTCTCCAACCGGCTTTACGATGCACCCGACGAGGAGCTGCCGGTGAAGCTGA
AAATGGAATCCCTGAGAGATTTCGGCCCGGAGGCCATTGTGGAGCAGGTCCCGGAGATGAAACGCCTGTT
GGAGTTGCGCGAGGCACTGCGGGCGCTGAAGGCTCCCCTCTCCAACATTCCGGACTTCCGGAGAAAAATT
CAGGAACTGGTCACTGACGATGCCGCCCGCGCCAAGCTGCTGGCTGAAATAGGGATCGAAGGGTAA