SecReT6
Protein ID: 409913615
SecReT6 ID603
T6SS typei1
Gene symboltssC
Locus tagKN400_3112
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]3375681..3377165 [+]
Producttype VI secretion system needle sheath protein TssC
NoteTssC
UniProt IDD7AEW5
KEGG IDgsk:KN400_3112
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-189, Aligned region: 67..492
Protein Sequence: 494 a.a.     [Download]
>gi|409913615|ref|YP_006892080.1| type VI secretion system needle sheath protein TssC [Geobacter sulfurreducens KN400]
MSSEMNGTAPFQDQGATDVSLLEDIVRVTKLQPADEAYSITRRGVAALMAQLLEPGAEARKVSKAVLDDM
IAEIDRKLSLQMDEILHHPQFQALESSWRSLHFLVDRTDFRENNRIEFLNATKEELLDDFEDAPEVAKSG
LYKTVYSAEYGQFGGKPFGAIIGNYDFGPGAQDIKLLQSLAAVAGMAHAPFMAAASPQFFGCDDFTALPN
LKDISSILEGPQYAKWQAFRESEDARYVGLALPRFLLRLPYGEATRPAKCFNYEEQVSDSHDRYCWGNAA
FAFATRLTESFANFRWCANIIGPQGGGTVHDLPLHQYQAMGAIQTKIPTEVLISERREFELAEGGFIALT
MRKGSDNAAFFSANSVQKPKFFGSSKEGKEAELNYKLGLQLPYMFIVSRLAHYLKVIQREHIGTWKERGD
LENELNLWIRQYVSEMDNPMPGVRSRRPLRQAEVTVEEVPGEPGWYRVGLKVTPHFKYMGAYFTLSLVGK
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|385795588|ref|NC_017454.1|:3375681-3377165 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGAGCTCAGAGATGAACGGCACTGCCCCCTTTCAGGACCAGGGTGCGACTGACGTGTCGCTTTTGGAGG
ATATCGTCCGGGTCACTAAACTTCAACCGGCCGACGAAGCTTACTCTATCACCAGAAGAGGGGTCGCGGC
CCTCATGGCCCAGCTTCTGGAGCCGGGAGCCGAAGCCCGGAAGGTATCCAAAGCAGTGCTTGATGACATG
ATCGCCGAAATCGACCGCAAGCTCTCCCTCCAGATGGACGAAATCCTCCACCACCCCCAGTTCCAGGCAC
TTGAATCATCCTGGCGTTCGCTCCACTTCCTGGTAGATCGAACCGACTTCAGGGAAAACAACCGGATCGA
ATTCCTGAACGCCACCAAGGAGGAACTGCTGGACGACTTCGAGGACGCGCCCGAGGTGGCCAAATCGGGC
CTCTACAAGACCGTTTACTCCGCCGAGTACGGTCAGTTCGGCGGTAAGCCGTTCGGAGCGATCATCGGCA
ACTACGACTTCGGTCCGGGGGCCCAGGACATAAAGCTCCTCCAGAGCCTGGCTGCCGTAGCCGGGATGGC
CCACGCCCCCTTCATGGCCGCCGCATCTCCCCAGTTCTTCGGCTGTGATGACTTCACCGCCCTGCCGAAT
CTCAAAGACATCTCATCGATCCTCGAAGGCCCCCAGTACGCCAAGTGGCAAGCGTTCCGCGAGAGCGAAG
ATGCCCGCTACGTGGGACTGGCCCTGCCCCGGTTCCTCCTGCGACTCCCCTACGGCGAGGCCACCAGGCC
GGCCAAGTGTTTCAACTACGAAGAACAGGTCTCCGACAGCCACGACCGCTACTGCTGGGGCAACGCAGCC
TTCGCCTTCGCCACCCGGCTCACCGAGAGCTTTGCCAACTTCCGCTGGTGCGCCAACATCATCGGTCCCC
AGGGTGGCGGAACGGTGCATGACCTGCCGCTCCACCAGTACCAGGCAATGGGAGCCATCCAGACCAAGAT
CCCCACCGAAGTGCTCATCAGCGAGCGCCGCGAATTCGAGCTGGCCGAAGGAGGGTTCATTGCCCTTACC
ATGCGAAAAGGCAGTGACAATGCCGCCTTCTTCTCCGCGAACTCGGTCCAGAAACCGAAATTCTTCGGCA
GCTCCAAGGAGGGAAAAGAGGCCGAGCTCAACTACAAGCTGGGGCTCCAGCTCCCCTATATGTTCATCGT
CAGTCGCCTCGCCCACTATCTGAAGGTGATCCAGCGGGAGCACATCGGCACGTGGAAGGAACGGGGCGAT
CTGGAGAATGAGCTCAATCTGTGGATTCGTCAGTACGTCTCCGAGATGGACAACCCCATGCCCGGCGTTC
GCAGCCGCCGTCCCCTGCGCCAGGCCGAAGTGACCGTTGAGGAAGTCCCGGGCGAACCGGGCTGGTACCG
GGTGGGCCTCAAGGTCACCCCTCACTTCAAGTACATGGGGGCATACTTCACGCTGTCACTGGTGGGGAAA
CTGGATAAAGAGTAG