SecReT6
Protein ID: 409913616
SecReT6 ID603
T6SS typei1
Gene symboltssD
Locus tagKN400_3113
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]3377247..3377732 [+]
Producttype VI secretion system needle tube protein TssD
NoteTssD
UniProt IDD7AEW6
KEGG IDgsk:KN400_3113
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.30E-40, Aligned region: 7..146
Protein Sequence: 161 a.a.     [Download]
>gi|409913616|ref|YP_006892081.1| type VI secretion system needle tube protein TssD [Geobacter sulfurreducens KN400]
MAMPAHMTLTGEKQGKIDGSCELQGRENTIQLYEMKHDIHMPRNPHDGLPTGKRVHGPLSIVKMFDKSSP
KLYQALCTGEHMKNVQIKWYRINKQGLEEHYFTTTLEDAIVVEMKPYMPMTLLPANEPYGHMEEVAFSYK
KIKWTWEPNGIEAEDSWSVPK
 
Nucleotide Sequence: 486 bp     [Download]
>gi|385795588|ref|NC_017454.1|:3377247-3377732 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGGCAATGCCCGCCCACATGACCCTGACTGGAGAAAAACAGGGAAAGATCGACGGTTCCTGCGAACTGC
AGGGGCGCGAAAACACTATCCAGCTTTACGAAATGAAGCACGACATCCACATGCCGCGCAATCCCCATGA
CGGCCTGCCCACCGGCAAGCGCGTCCATGGCCCCCTGTCGATCGTCAAGATGTTCGACAAGAGTTCGCCG
AAACTCTATCAGGCCCTCTGCACCGGAGAGCACATGAAAAACGTGCAGATCAAGTGGTACCGTATCAACA
AACAAGGGCTGGAAGAGCACTATTTCACCACCACCCTTGAGGATGCCATCGTGGTCGAGATGAAACCCTA
CATGCCCATGACGCTCCTTCCTGCGAACGAGCCCTACGGCCATATGGAAGAGGTGGCATTCTCCTACAAG
AAGATCAAGTGGACCTGGGAGCCCAACGGTATCGAGGCTGAGGATTCCTGGAGCGTGCCCAAGTAG