SecReT6
Protein ID: 409913619
SecReT6 ID603
T6SS typei1
Gene symboltssI
Locus tagKN400_3114
StrainGeobacter sulfurreducens KN400
Repliconchromosome [GenBank: NC_017454] [Browse all T6SS(s) in this replicon]
Location [Strand]3379335..3381428 [+]
Producttype VI secretion system needle syringe protein TssI
NoteTssI
UniProt IDD7AEW7
KEGG IDgsk:KN400_3114
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-75, Aligned region: 39..332
Phage_base_V [PF04717], Evalue: 1.20E-22, Aligned region: 373..467
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 517..526
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 528..550
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 552..566
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 559..582
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 567..589
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 604..622
Gp5_C [PF06715], Evalue: 2.20E-11, Aligned region: 631..654
Protein Sequence: 697 a.a.     [Download]
>gi|409913619|ref|YP_006892084.1| type VI secretion system needle syringe protein TssI [Geobacter sulfurreducens KN400]
MTIQKAAASLLSQGSTSSFQFEIPATRHLLSVAGFTVDERISHPYDIHLTLATKDNVDLDEVIDKEAVLS
VDHEGGTRYFHGVVREFTSLGTDGDYDLYHAHIVPALWFLSLEQDCRVFQFKNVQDIVAEILEESNITSD
RYRFALSREDRLRKFCVQYRETDLNFVSRLLEEEGIFYFFEHYEDKHVIVFSDTGSGYLYMPGKRQIPFN
TNDGMVPGKESVFDFIYSRRVRPGKVSQRDYCYKHTNLDLTTQRQGKVSAQREVYDFPGNYFNEERGTYL
ANVRLERLLVLGATAEGQSSCPRMMPGHEWELSGHDYAGKYLPVAVIHHGAQPQVLGEHAGDGGFRYDNE
FIAVPAAVTVRPQIVAGRPAIVGLQTAVVTGSPGEEIHADPDGYLRVKVQFPWDRRGRKDGRTSCWVRVG
QPWGGGGWGTQFLPRVGDEVLVTFLEGDPDRPMVIGSAYNSENQPLYALPASKTQSGIRTRSYPNGGTDN
FHELRFEDKKGSEEIYLQSEKDWNILVKNDKGQTVGRNESLTVGNNRSKTVGVDQSESVGVNKSIQVGAN
HNESIGANMTLSVGGFKNETVGINSLETIGGAKELAIGGLYQVAVGGVMNETVAGAKTEEVGLAKAVFVG
NNMSENVKGDRTTNTNGNYTETISAKYYAKADEYVIEAPKITLKAGSSSIVMDGSSITIKASKIFQN
 
Nucleotide Sequence: 2094 bp     [Download]
>gi|385795588|ref|NC_017454.1|:3379335-3381428 Geobacter sulfurreducens KN400 chromosome, complete genome
ATGACAATCCAAAAGGCCGCGGCAAGCCTCCTTTCTCAGGGCTCAACATCAAGCTTTCAGTTCGAGATTC
CCGCCACCAGGCACTTACTGTCGGTAGCGGGATTCACCGTCGACGAGCGTATATCCCATCCCTATGACAT
CCACCTCACCCTGGCCACAAAGGACAATGTGGATCTCGACGAGGTGATCGACAAGGAAGCCGTGCTTTCC
GTAGATCATGAGGGCGGAACGCGCTATTTCCACGGTGTTGTCCGGGAATTCACCTCTCTCGGGACGGACG
GCGACTACGACCTCTACCACGCCCACATTGTGCCGGCCCTGTGGTTCCTTTCGCTGGAGCAGGATTGCCG
TGTTTTCCAGTTCAAGAACGTTCAGGACATAGTCGCCGAAATCCTCGAAGAGAGTAATATCACCAGTGAC
CGCTACCGCTTCGCACTCTCCAGGGAGGACCGCCTGCGCAAATTCTGCGTCCAGTACCGGGAAACGGACC
TGAACTTTGTCTCGCGACTTCTCGAAGAGGAGGGAATCTTCTACTTTTTCGAGCACTACGAAGACAAGCA
CGTCATCGTCTTTTCCGACACCGGCTCAGGCTATCTCTACATGCCCGGCAAGCGCCAGATCCCCTTCAAC
ACCAATGACGGCATGGTGCCCGGAAAGGAGAGCGTCTTCGACTTCATCTACTCGCGCCGCGTTCGCCCCG
GCAAGGTGTCACAGCGCGATTATTGCTACAAGCACACGAACCTCGACTTGACCACCCAGCGGCAGGGAAA
GGTGTCCGCTCAGCGGGAGGTCTACGACTTCCCCGGCAATTACTTCAATGAGGAACGAGGTACCTATCTG
GCCAACGTCCGCCTGGAGCGATTGCTGGTGCTCGGCGCGACCGCAGAAGGGCAGAGTTCGTGCCCTCGCA
TGATGCCGGGACACGAGTGGGAACTTTCCGGCCACGATTATGCCGGGAAGTATCTGCCAGTGGCAGTCAT
CCATCATGGCGCTCAGCCCCAGGTGCTTGGCGAGCATGCCGGAGATGGCGGCTTTCGCTACGACAACGAA
TTTATCGCCGTGCCGGCCGCCGTAACGGTCCGCCCCCAGATTGTCGCCGGCAGGCCCGCCATCGTCGGAC
TCCAGACTGCCGTCGTTACCGGCTCGCCCGGCGAAGAAATCCACGCCGACCCCGACGGCTACCTGCGGGT
GAAAGTGCAGTTTCCCTGGGACCGGCGTGGCCGGAAGGATGGCAGGACCTCATGCTGGGTCAGGGTCGGC
CAGCCCTGGGGAGGCGGTGGATGGGGAACCCAGTTTCTGCCCCGTGTTGGAGACGAGGTGCTTGTCACGT
TCCTTGAAGGCGACCCCGACCGCCCCATGGTAATCGGCAGTGCGTACAACTCCGAAAATCAACCACTGTA
CGCTTTGCCCGCCAGTAAAACCCAGAGCGGCATCCGCACCCGCAGCTACCCAAACGGCGGTACTGACAAT
TTCCATGAACTCCGCTTCGAGGATAAGAAGGGAAGCGAGGAGATCTACCTGCAGAGCGAAAAGGACTGGA
ACATTCTGGTTAAAAACGACAAGGGGCAGACTGTCGGGCGGAACGAGAGCCTGACCGTCGGCAACAACCG
CTCAAAAACGGTGGGGGTGGATCAGAGCGAGAGTGTCGGTGTCAACAAGTCCATCCAGGTAGGGGCAAAC
CACAACGAAAGCATCGGCGCCAACATGACTCTGAGCGTAGGCGGTTTCAAGAATGAGACTGTCGGCATAA
ATTCACTCGAAACAATCGGCGGTGCAAAGGAGCTAGCCATTGGCGGCCTCTACCAAGTTGCGGTAGGCGG
CGTCATGAACGAGACGGTTGCCGGCGCCAAAACGGAAGAAGTCGGACTGGCAAAAGCGGTGTTCGTCGGC
AACAACATGAGTGAGAACGTAAAAGGTGACAGAACCACCAATACAAACGGCAACTACACGGAAACCATCA
GCGCCAAATATTACGCCAAAGCTGACGAATATGTCATCGAGGCGCCCAAAATCACGCTTAAGGCCGGTTC
TTCATCCATTGTCATGGATGGGAGCAGCATAACGATCAAGGCGAGCAAAATTTTCCAGAATTGA