SecReT6
Protein ID: 410471495
SecReT6 ID709
T6SS typeN/A
Gene symbolvrgS
Locus tagBN117_0746
StrainBordetella parapertussis Bpp5
Repliconchromosome [GenBank: NC_018828] [Browse all T6SS(s) in this replicon]
Location [Strand]796556..798895 [+]
Producthypothetical protein
NoteTssI
UniProt IDK0MAM8
KEGG IDbpar:BN117_0746
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-88, Aligned region: 31..335
Phage_GPD [PF05954], Evalue: 1.50E-88, Aligned region: 637..642
Phage_base_V [PF04717], Evalue: 2.90E-25, Aligned region: 371..464
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 507..529
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 514..536
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 530..551
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 548..567
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 564..575
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 604..624
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 610..631
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 628..648
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 652..664
Gp5_C [PF06715], Evalue: 5.70E-10, Aligned region: 668..686
Protein Sequence: 779 a.a.     [Download]
>gi|410471495|ref|YP_006894776.1| hypothetical protein BN117_0746 [Bordetella parapertussis Bpp5]
METILAMAERIVRALTPLPPQALQFRSMHGHEGLSALYEFEVDLLAATHTLELKSLLGKPVSLEIETGGA
PRYLSGQATRCALVGREGDSARQYVYRVTMRPWLWYLTQTSDSKIFQQMSVVDVLRQVLADYPFPVEYRL
AGSYRRWEYCVQYQETDFAFVSRLMEHEGIYYWFRHESGKHTLVLTDDITQHDECPGAAQLPYYGPDRAT
VPQEQYVSQWQVAEEITPDGFATVDYDFKKPAASLDAQSSNLGAYEPGGLQVYEWLGGYTEPDQGERYSR
IRLEALQAHGESVTGACNVRAFAPGYLFTLRNHPRPAENRQYLIAQAHYRIQEGGYASGAEDAVFDIDFR
VLPATVPFRVARATPVPRTHGPQTATVVGQAGEEIWTDEYGRVKVHFHWDRYGKKNENSSCWVRVSSPWA
GGGFGGIQLPRVGDEVIVDFIGGYPDRPIVIGRVYNASNMPPWDLPGNATQSGFLSRSKNGDRGTANALM
FEDSAGAERIWLHAERDMDCEVEANESHTVDGNRTTLIGGNDTLTVRGMRTTTIDGLDTETFNAGATRTV
TGEVSETTTGNETRTFNGDVTETVNGVETRTVNGDWKETITGEMTETRTGDETRTVTGAVTETITGAVTQ
TQTGAHDITITGDQTSSITGAVSHTVTGAYTQTVTDPVTVNANTSMTVVTPSWTVSSASQQAFWTANTLR
GTPARLTVVGAAADFWGVRQQVYGGINSQWSTVKIDLAAFKNGANGFESGQAGAQIKAIGAQIKTGGAAV
ISRVINLFT
 
Nucleotide Sequence: 2340 bp     [Download]
>gi|410470815|ref|NC_018828.1|:796556-798895 Bordetella parapertussis Bpp5, complete genome
ATGGAGACGATCCTCGCAATGGCCGAACGCATCGTACGCGCCCTGACCCCGCTGCCCCCGCAAGCCCTGC
AGTTTCGCAGCATGCACGGCCACGAAGGCCTGTCGGCGCTGTACGAATTCGAGGTGGACCTGCTGGCGGC
CACCCATACGCTGGAACTGAAATCGCTGCTGGGCAAGCCGGTTTCGCTGGAAATCGAAACCGGCGGCGCG
CCGCGCTACCTGTCGGGCCAGGCGACCCGCTGCGCCCTGGTGGGGCGCGAAGGCGACAGCGCGCGCCAGT
ATGTGTACCGGGTGACCATGCGGCCCTGGCTGTGGTATCTGACGCAGACCTCGGACAGCAAGATCTTCCA
GCAGATGTCGGTGGTGGACGTGCTGCGCCAGGTGCTGGCCGACTACCCGTTTCCGGTCGAGTATCGGCTG
GCCGGCAGCTACCGCCGCTGGGAATACTGCGTGCAGTACCAGGAAACCGATTTCGCCTTCGTCAGCCGCC
TGATGGAGCACGAGGGCATCTATTACTGGTTCCGCCACGAGTCGGGCAAGCACACGCTGGTGCTGACCGA
CGACATCACCCAGCACGACGAGTGCCCGGGCGCGGCGCAGCTGCCGTATTACGGCCCGGATCGCGCCACG
GTGCCTCAGGAGCAATACGTATCGCAGTGGCAGGTGGCCGAGGAGATCACGCCCGATGGCTTCGCCACCG
TGGACTACGACTTCAAGAAGCCGGCCGCCAGCCTGGACGCGCAATCGAGCAACCTGGGGGCCTACGAGCC
GGGCGGGCTGCAGGTGTACGAGTGGCTGGGCGGCTACACCGAGCCGGACCAGGGCGAGCGCTATTCGCGC
ATCCGCCTGGAAGCCCTGCAGGCGCACGGCGAAAGCGTGACCGGCGCGTGCAACGTGCGCGCCTTCGCGC
CGGGCTACCTGTTCACGCTGCGCAACCATCCGCGCCCGGCCGAGAACCGCCAATACCTGATCGCGCAGGC
GCATTACCGCATCCAGGAAGGCGGCTACGCCAGCGGCGCCGAGGATGCCGTCTTCGATATCGACTTCCGC
GTCCTGCCGGCCACGGTGCCGTTTCGCGTGGCGCGCGCCACTCCGGTGCCGCGCACGCACGGGCCGCAGA
CCGCCACGGTGGTGGGCCAGGCCGGCGAAGAGATCTGGACCGACGAGTACGGCCGCGTCAAGGTGCACTT
CCACTGGGACCGCTACGGCAAGAAGAACGAGAACAGCTCGTGCTGGGTGCGCGTGTCCAGCCCCTGGGCC
GGCGGCGGCTTCGGCGGCATCCAGCTGCCGCGCGTGGGCGACGAAGTGATCGTGGACTTCATCGGCGGCT
ATCCCGACCGGCCCATTGTCATCGGCCGCGTCTACAACGCCAGCAACATGCCGCCCTGGGACCTGCCCGG
CAACGCCACGCAAAGCGGGTTTCTCAGCCGCTCCAAGAACGGCGACCGGGGCACCGCCAACGCGCTGATG
TTCGAGGACAGCGCGGGCGCCGAACGCATCTGGCTGCACGCCGAGCGCGACATGGACTGCGAGGTCGAGG
CCAACGAGTCGCACACGGTCGACGGCAACCGCACCACCCTGATCGGCGGCAACGATACGCTGACGGTGCG
GGGCATGCGCACCACCACCATAGACGGGCTGGACACCGAAACCTTCAATGCCGGCGCCACGCGCACCGTC
ACCGGCGAGGTGTCGGAGACCACCACCGGCAACGAGACGCGCACCTTCAACGGCGATGTGACCGAAACCG
TCAACGGCGTGGAGACGCGCACGGTCAACGGCGACTGGAAGGAAACCATCACCGGCGAGATGACCGAAAC
GCGCACGGGCGACGAAACCCGCACGGTGACCGGCGCCGTCACGGAAACCATCACCGGCGCGGTCACGCAA
ACGCAGACCGGCGCGCACGACATCACCATCACCGGCGACCAGACCTCCAGCATCACCGGCGCGGTGTCGC
ACACGGTCACCGGCGCGTATACCCAGACGGTCACCGACCCGGTCACGGTCAACGCCAACACCAGCATGAC
CGTGGTCACGCCGTCGTGGACCGTCTCGTCGGCGTCGCAGCAGGCGTTCTGGACCGCCAACACCTTGCGC
GGCACGCCGGCGCGCCTGACGGTGGTCGGCGCCGCGGCCGACTTCTGGGGCGTGCGCCAGCAGGTCTACG
GCGGCATCAACTCGCAGTGGTCCACCGTGAAGATCGACCTGGCCGCGTTCAAGAACGGCGCCAACGGCTT
CGAGAGCGGCCAGGCCGGCGCGCAGATCAAGGCCATCGGCGCGCAGATCAAGACCGGCGGGGCGGCGGTG
ATCTCGCGCGTCATCAATCTCTTCACCTAG