SecReT6
Protein ID: 410471502
SecReT6 ID709
T6SS typeN/A
Gene symbol-
Locus tagBN117_0756
StrainBordetella parapertussis Bpp5
Repliconchromosome [GenBank: NC_018828] [Browse all T6SS(s) in this replicon]
Location [Strand]807691..809964 [+]
ProductATPase
NoteTssH
UniProt IDK0MED0
KEGG IDbpar:BN117_0756
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-37, Aligned region: 190..269
AAA_2 [PF07724], Evalue: 1.60E-37, Aligned region: 489..655
AAA [PF00004], Evalue: 2.80E-20, Aligned region: 191..322
AAA [PF00004], Evalue: 2.80E-20, Aligned region: 495..578
ClpB_D2-small [PF10431], Evalue: 3.50E-14, Aligned region: 662..736
AAA_5 [PF07728], Evalue: 3.80E-13, Aligned region: 191..218
AAA_5 [PF07728], Evalue: 3.80E-13, Aligned region: 494..604
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 61..72
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 168..213
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 236..270
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 333..359
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 379..457
AAA_16 [PF13191], Evalue: 2.10E-12, Aligned region: 464..539
AAA_22 [PF13401], Evalue: 3.50E-10, Aligned region: 191..272
AAA_22 [PF13401], Evalue: 3.50E-10, Aligned region: 323..358
AAA_22 [PF13401], Evalue: 3.50E-10, Aligned region: 493..517
AAA_22 [PF13401], Evalue: 3.50E-10, Aligned region: 555..578
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 185..270
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 345..362
Sigma54_activat [PF00158], Evalue: 1.40E-08, Aligned region: 494..594
Clp_N [PF02861], Evalue: 3.70E-07, Aligned region: 26..75
Clp_N [PF02861], Evalue: 3.70E-07, Aligned region: 111..135
AAA_17 [PF13207], Evalue: 8.80E-07, Aligned region: 24..106
AAA_17 [PF13207], Evalue: 8.80E-07, Aligned region: 191..246
AAA_17 [PF13207], Evalue: 8.80E-07, Aligned region: 493..530
IstB_IS21 [PF01695], Evalue: 4.80E-06, Aligned region: 173..213
IstB_IS21 [PF01695], Evalue: 4.80E-06, Aligned region: 494..514
AAA_18 [PF13238], Evalue: 2.10E-05, Aligned region: 191..225
AAA_18 [PF13238], Evalue: 2.10E-05, Aligned region: 495..523
NACHT [PF05729], Evalue: 2.10E-05, Aligned region: 191..223
NACHT [PF05729], Evalue: 2.10E-05, Aligned region: 494..522
AAA_14 [PF13173], Evalue: 4.80E-05, Aligned region: 191..271
AAA_14 [PF13173], Evalue: 4.80E-05, Aligned region: 493..589
AAA_19 [PF13245], Evalue: 5.80E-05, Aligned region: 190..215
AAA_19 [PF13245], Evalue: 5.80E-05, Aligned region: 341..368
AAA_19 [PF13245], Evalue: 5.80E-05, Aligned region: 492..520
AAA_29 [PF13555], Evalue: 6.70E-05, Aligned region: 183..207
AAA_29 [PF13555], Evalue: 6.70E-05, Aligned region: 492..519
Zeta_toxin [PF06414], Evalue: 8.80E-05, Aligned region: 190..212
Zeta_toxin [PF06414], Evalue: 8.80E-05, Aligned region: 485..534
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 35..65
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 186..215
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 245..283
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 317..415
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 492..520
AAA_25 [PF13481], Evalue: 0.00018, Aligned region: 669..720
Arch_ATPase [PF01637], Evalue: 0.00087, Aligned region: 170..207
Arch_ATPase [PF01637], Evalue: 0.00087, Aligned region: 243..274
Arch_ATPase [PF01637], Evalue: 0.00087, Aligned region: 493..515
Arch_ATPase [PF01637], Evalue: 0.00087, Aligned region: 559..576
Hpr_kinase_C [PF07475], Evalue: 0.0035, Aligned region: 191..203
Hpr_kinase_C [PF07475], Evalue: 0.0035, Aligned region: 491..513
RNA_helicase [PF00910], Evalue: 0.0043, Aligned region: 192..212
RNA_helicase [PF00910], Evalue: 0.0043, Aligned region: 495..516
NTPase_1 [PF03266], Evalue: 0.0052, Aligned region: 191..213
NTPase_1 [PF03266], Evalue: 0.0052, Aligned region: 242..268
NTPase_1 [PF03266], Evalue: 0.0052, Aligned region: 494..515
DUF815 [PF05673], Evalue: 0.0054, Aligned region: 184..267
DUF815 [PF05673], Evalue: 0.0054, Aligned region: 489..533
Mg_chelatase [PF01078], Evalue: 0.0084, Aligned region: 189..208
Mg_chelatase [PF01078], Evalue: 0.0084, Aligned region: 346..360
Mg_chelatase [PF01078], Evalue: 0.0084, Aligned region: 494..515
Mg_chelatase [PF01078], Evalue: 0.0084, Aligned region: 525..583
T2SE [PF00437], Evalue: 0.0097, Aligned region: 178..205
T2SE [PF00437], Evalue: 0.0097, Aligned region: 489..572
Protein Sequence: 757 a.a.     [Download]
>gi|410471502|ref|YP_006894783.1| ATPase [Bordetella parapertussis Bpp5]
MSDIGRAELFGKLDSLSYRALEDATALCKLRGNPYVELAHWVHAIAHAQDSDLHHIARAFELDLGALQQD
LVRALDQLPRGAGAVSDLSEHVDHVVERAWALASLRYGAARIRSGHLLLALLRDPSLRGVLAGMSGQFAR
VVPDLLLQGLPEMTRGSPEARAGRLDPVSGRDDEIRQLIDVLMRRRQNNPLLTGEAGVGKTAVVEGLALR
LARGDVPAPLREVALYLLDIGLLQAGAGVKGEFEQRLRQVIDAVQGSERPIVLFIDEIHTLVGAGGAAGT
GDAANLLKPALARGQLRTIGATTWAEYKQYIEKDPALTRRFQAIQVHEPDEAGARRMLRGLAGALQAHHG
VLLLDEAVEAAVRLSHRYIPARQLPDKAVALLDTACARVAVSQQSAPALRAALREAADALARSQGEAPLI
HPAVDAAAVAAVVADWTGIPVGRMVRDEAQAVLALADTLERRVVGQRHALELIARRIQTARAGLTDPGKP
VGVFLLCGPSGVGKTETALALAEALYGGEQNLITINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVR
RRPHSVVLLDEVEKAHADVHEIFFQVFDKGWMEDGEGRYIDFRNTVILLTANVGADLIASLCADPELAPE
PDALAAALRAPLRDVFPAALLGRLAAVPYLPLSDSMLAHIVALQFERVGQRLRERHGMDLEVEPAAAELV
VARCVEVESGARMVDAILSQRVLPQIGRELLGASLQQRTWRRVRVRAVDGEFACEYE
 
Nucleotide Sequence: 2274 bp     [Download]
>gi|410470815|ref|NC_018828.1|:807691-809964 Bordetella parapertussis Bpp5, complete genome
ATGTCCGATATCGGCCGCGCCGAGCTGTTCGGCAAACTCGATTCCCTGTCCTATCGCGCCCTGGAGGACG
CCACCGCCCTGTGCAAGCTGCGCGGCAATCCCTACGTGGAGCTGGCGCACTGGGTGCACGCCATCGCGCA
CGCGCAGGACAGCGACCTGCACCATATCGCGCGCGCGTTCGAGCTGGATCTCGGCGCGCTGCAGCAAGAC
CTGGTGCGCGCGCTCGACCAATTGCCGCGCGGGGCGGGGGCGGTCTCGGACCTCTCCGAGCACGTGGACC
ACGTGGTGGAACGCGCCTGGGCGCTGGCGTCGCTGCGCTACGGCGCTGCGCGCATCCGCAGCGGGCACCT
GCTGCTGGCGCTGCTGCGCGACCCCAGCCTGCGCGGCGTGCTGGCCGGCATGTCGGGGCAGTTCGCCCGC
GTCGTGCCAGACCTGCTGCTGCAAGGCCTGCCCGAGATGACGCGCGGCTCGCCCGAGGCGCGCGCCGGCC
GGCTCGATCCGGTGAGCGGGCGCGACGACGAAATCCGCCAGTTGATCGACGTGCTGATGCGGCGGCGCCA
GAACAATCCCCTGCTCACCGGCGAGGCCGGCGTGGGCAAGACCGCGGTGGTCGAGGGCCTGGCCCTGCGG
CTGGCGCGCGGCGATGTGCCGGCGCCGCTGCGCGAGGTGGCGCTGTACCTGCTGGATATCGGGCTGCTGC
AGGCCGGCGCCGGCGTCAAGGGCGAGTTCGAGCAGCGCCTGCGCCAGGTCATCGACGCGGTGCAGGGCAG
CGAACGCCCCATCGTGCTGTTCATCGACGAAATCCATACCCTGGTGGGGGCCGGCGGCGCGGCGGGGACG
GGCGATGCCGCCAACCTGCTCAAGCCGGCGCTGGCGCGCGGACAGCTGCGCACCATCGGCGCCACGACCT
GGGCCGAATACAAGCAGTACATCGAGAAAGACCCGGCGCTGACGCGGCGCTTCCAGGCCATCCAGGTGCA
CGAGCCCGACGAGGCCGGCGCGCGGCGCATGCTGCGCGGCCTGGCCGGCGCCCTGCAGGCGCATCATGGC
GTGCTGCTGCTGGACGAGGCCGTGGAGGCCGCCGTGCGGCTGTCGCATCGCTACATCCCGGCGCGCCAGT
TGCCGGACAAGGCGGTCGCCCTGCTCGACACGGCCTGCGCGCGCGTGGCGGTCAGCCAGCAGTCCGCGCC
GGCCTTGCGCGCCGCGCTGCGCGAGGCCGCCGACGCGCTGGCGCGCAGCCAGGGCGAGGCGCCGCTGATC
CACCCGGCGGTCGATGCCGCGGCCGTGGCGGCCGTGGTGGCCGATTGGACCGGCATCCCCGTGGGCCGCA
TGGTGCGCGACGAAGCGCAGGCCGTGCTGGCGCTGGCCGACACCCTGGAGCGCCGCGTCGTCGGCCAGCG
CCATGCGCTGGAACTGATCGCGCGCCGCATCCAGACCGCGCGCGCCGGTCTGACCGACCCGGGCAAGCCG
GTCGGCGTGTTCCTGCTGTGCGGCCCGAGCGGCGTGGGCAAGACCGAGACCGCGCTGGCCCTGGCCGAGG
CCCTGTATGGCGGCGAGCAGAATCTCATCACCATCAACATGAGCGAGTTCCAGGAGTCGCACACGGTGTC
GACCCTGAAGGGCGCGCCGCCGGGCTATGTGGGCTACGGCGAGGGCGGCGTGCTGACCGAAGCGGTGCGG
CGCCGCCCGCACAGCGTGGTGCTGCTCGACGAGGTCGAGAAAGCCCACGCCGACGTGCACGAGATTTTCT
TCCAGGTGTTCGACAAGGGGTGGATGGAAGACGGCGAAGGCCGTTACATCGATTTCCGCAACACGGTCAT
CCTGTTGACCGCCAACGTGGGCGCGGACCTGATCGCCAGCCTGTGCGCCGACCCCGAGCTGGCGCCCGAG
CCCGACGCGCTGGCGGCGGCCCTGCGCGCGCCGCTGCGCGACGTGTTTCCCGCGGCCTTGCTGGGCCGCC
TGGCGGCCGTGCCCTATCTGCCGCTGTCGGACAGCATGCTGGCGCACATCGTGGCCTTGCAGTTCGAACG
CGTCGGCCAGCGCTTGCGCGAGCGCCACGGCATGGATTTGGAAGTCGAGCCGGCCGCCGCCGAGCTGGTG
GTGGCGCGCTGCGTCGAGGTCGAATCCGGCGCGCGCATGGTCGACGCCATCCTGAGCCAGCGCGTCCTGC
CGCAGATCGGCCGCGAATTGCTGGGCGCCTCCCTGCAGCAACGCACCTGGCGCCGCGTGCGGGTGCGGGC
GGTCGACGGCGAGTTCGCCTGCGAGTACGAGTAG