SecReT6
Protein ID: 410471504
SecReT6 ID709
T6SS typeN/A
Gene symbol-
Locus tagBN117_0759
StrainBordetella parapertussis Bpp5
Repliconchromosome [GenBank: NC_018828] [Browse all T6SS(s) in this replicon]
Location [Strand]811435..811977 [+]
Productlipoprotein
NoteTssJ
UniProt IDK0MAN2
KEGG IDbpar:BN117_0759
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-39, Aligned region: 21..167
Protein Sequence: 180 a.a.     [Download]
>gi|410471504|ref|YP_006894785.1| lipoprotein [Bordetella parapertussis Bpp5]
MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADPRVNPDASGRPSPIQVTLYELRSSAE
FEARDFFTLQGDAQAALGKSLIETDQVILQPGETRKLSYPGNTEARVVGIVAAYRDLERSPWRIVVPLPQ
AQNTNIYKFWQFSPNEETVRVAVGGQGVQIVDRERSWWPF
 
Nucleotide Sequence: 543 bp     [Download]
>gi|410470815|ref|NC_018828.1|:811435-811977 Bordetella parapertussis Bpp5, complete genome
TTGCTTGTTGCTGTGCCCACGCGGCGCGCGTTGCGCGCGGCGGCCTGGATTGCCGTCGCGGTGCTGGCCG
CCGGGTGCGCGTCCACGGCCAGCCGCAAGGCGGCGCCTTACGCGATCGAGCTGAAGGCCGATCCGCGCGT
CAATCCCGATGCCTCGGGCCGGCCCTCGCCGATCCAGGTCACGCTGTACGAGCTGCGTTCGTCCGCCGAG
TTCGAGGCGCGCGATTTCTTCACCCTGCAAGGCGACGCGCAGGCCGCGCTGGGCAAGTCGCTCATCGAAA
CCGACCAGGTCATCCTGCAGCCCGGCGAAACCCGCAAGCTGTCGTATCCGGGCAATACCGAGGCGCGCGT
GGTCGGCATCGTGGCGGCCTATCGCGACCTCGAGCGCAGTCCCTGGCGCATCGTCGTGCCCCTGCCGCAG
GCCCAGAACACCAACATCTACAAGTTCTGGCAGTTCTCGCCCAACGAGGAGACCGTGCGCGTCGCGGTGG
GCGGACAGGGCGTGCAAATCGTCGACCGGGAGCGTTCCTGGTGGCCCTTCTGA