SecReT6
Protein ID: 410471505
SecReT6 ID709
T6SS typeN/A
Gene symbol-
Locus tagBN117_0760
StrainBordetella parapertussis Bpp5
Repliconchromosome [GenBank: NC_018828] [Browse all T6SS(s) in this replicon]
Location [Strand]812023..813357 [+]
Producthypothetical protein
NoteTssK
UniProt IDK0MBE4
KEGG IDbpar:BN117_0760
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-156, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|410471505|ref|YP_006894786.1| hypothetical protein BN117_0760 [Bordetella parapertussis Bpp5]
MALDNKVVWSEGMFLRPQHFQQFERHIEAQLRVRAAAASGCGWGYTALEIDRDALALGKLALARAAGVLP
DGTPFEFERADEGPPALDIDPAMRDARVMLALPRRRAGACEVVYEDGADTLARYCVHEGEIEDSGSVGLE
PALVQLGRLRLRLVSETELGDEWVALGAARVLERRADHRVVLDEMYIPPWLAADANPALRGYAGELSGLL
QARGAALAQRLAQPGRGGVSEVADFLLLALVNRYAGALWHARQVPALHPERLFRDWLMLACDLATYTCAT
RLPEVLPDYRHDDLQASFGPLMAELRRSLSVVLEQHAVQIPLHDRGQGVRVAQIADAELLRSAGFVLAVH
ADMPAETVRTRFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPYSAGHVYFELDKNGEFWRQLER
TGALALHLAGEFPGLALEFWAVRD
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|410470815|ref|NC_018828.1|:812023-813357 Bordetella parapertussis Bpp5, complete genome
ATGGCACTGGACAACAAGGTCGTCTGGTCGGAGGGCATGTTCCTGCGGCCGCAACATTTCCAGCAGTTCG
AACGGCATATCGAGGCGCAGTTGCGCGTGCGCGCCGCGGCGGCCTCGGGCTGCGGCTGGGGCTACACCGC
GCTGGAGATCGATCGCGACGCGCTGGCGCTGGGCAAGCTGGCGCTGGCGCGCGCCGCGGGCGTGCTGCCC
GACGGCACGCCGTTCGAGTTCGAGCGCGCCGACGAGGGGCCGCCGGCGCTGGACATCGACCCGGCCATGC
GCGATGCGCGCGTGATGCTGGCGCTGCCGCGCCGCCGCGCCGGCGCCTGCGAAGTGGTCTACGAAGACGG
CGCGGATACGCTGGCGCGCTATTGCGTGCATGAAGGCGAGATCGAGGACTCCGGCTCGGTGGGCCTGGAG
CCGGCGCTGGTGCAGCTGGGCCGTTTGCGCCTGCGGCTGGTTTCCGAAACCGAGCTGGGCGACGAATGGG
TGGCGCTGGGCGCCGCGCGGGTGCTGGAGCGCCGCGCCGACCACCGCGTGGTGCTCGACGAGATGTACAT
CCCGCCCTGGCTGGCCGCCGACGCCAATCCGGCGCTGCGCGGCTATGCCGGCGAGCTGTCCGGGCTGCTG
CAGGCGCGCGGAGCGGCGCTGGCGCAGCGGCTGGCGCAGCCGGGCCGCGGCGGCGTCTCCGAAGTGGCCG
ACTTCCTGCTGCTGGCGCTGGTAAACCGCTACGCCGGCGCGCTGTGGCACGCGCGCCAGGTGCCGGCCCT
GCATCCCGAACGGCTGTTTCGCGACTGGCTGATGCTGGCCTGCGACCTGGCCACCTATACCTGCGCCACG
CGCCTGCCCGAGGTGCTGCCCGATTACCGCCACGACGACCTGCAGGCCAGTTTCGGGCCGCTCATGGCCG
AGCTGCGCCGCTCGCTGTCGGTGGTGCTGGAGCAGCACGCCGTGCAGATCCCGCTGCATGACCGCGGCCA
GGGCGTGCGCGTGGCGCAGATCGCCGATGCCGAACTGCTGCGCAGCGCCGGCTTCGTGCTGGCCGTGCAC
GCCGACATGCCGGCCGAGACGGTGCGCACGCGCTTTCCGGCCCAGGTCAAGATCGGCCCGGTCGAGCGCA
TCCGCGACCTGGTGCACCTGCAATTGCCCGGCGTGGCGGTGCGCGCCCTGCCGGTGGCGCCGCGCCAGAT
TCCCTACAGCGCGGGCCACGTGTACTTCGAGCTGGACAAGAACGGCGAGTTCTGGCGGCAGCTGGAGCGC
ACCGGCGCGCTGGCCCTGCACCTGGCGGGCGAGTTTCCCGGCCTGGCGCTGGAGTTCTGGGCCGTGCGCG
ACTGA