SecReT6
Protein ID: 410471506
SecReT6 ID709
T6SS typeN/A
Gene symbol-
Locus tagBN117_0761
StrainBordetella parapertussis Bpp5
Repliconchromosome [GenBank: NC_018828] [Browse all T6SS(s) in this replicon]
Location [Strand]813378..814658 [+]
Productouter membrane protein
NoteTssL
UniProt IDK0MDM0
KEGG IDbpar:BN117_0761
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-75, Aligned region: 36..241
OmpA [PF00691], Evalue: 7.70E-14, Aligned region: 305..403
RskA [PF10099], Evalue: 0.003, Aligned region: 179..298
RskA [PF10099], Evalue: 0.003, Aligned region: 363..387
Protein Sequence: 426 a.a.     [Download]
>gi|410471506|ref|YP_006894787.1| outer membrane protein [Bordetella parapertussis Bpp5]
MHAANPSFPDFGADAAADPGAASRLRPHEYVISGSNPLVAAANPLLDLIPQIRATTAHPAPAMLREYLVD
EVRQFELRAQQAGIPNETILGARYCLCTALDEAAALTPWGGGGVWSAHSLLVTFHNETWGGEKFFQLLAK
LSQNPGQHLDLLELLYYCLLLGFEGRYRVIDNGRTQLETLRQRLLRILRGARGEYPRALSPHWRDTPVQQ
ALRRLPVPLWAYGALAAALALALFWGLSWRLGERSDAVFAAVARLKPPTVQIAPAPRPAPAPRLAVFLQP
EVRDRLVTVRDEVDRSVVVLRGDGLFESGAVAVRDRYAPVLARVAEALGQTRGDIVVRGYTDNVPIRTAR
FPSNWHLSQARAEAVKAVIDARLGQAGRVRAEGRGEADPLAPNDTPAGRSVNRRVEITVMVPPAPHARTP
EEGATP
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|410470815|ref|NC_018828.1|:813378-814658 Bordetella parapertussis Bpp5, complete genome
ATGCACGCCGCCAATCCTTCCTTTCCCGACTTCGGCGCCGACGCGGCGGCCGACCCCGGCGCGGCCAGCC
GGCTGCGCCCGCACGAGTACGTCATCAGCGGCTCCAACCCGCTGGTGGCGGCGGCCAATCCGCTGCTGGA
CCTGATCCCGCAGATCCGCGCCACCACGGCCCATCCCGCGCCGGCCATGCTGCGCGAGTACCTGGTCGAC
GAAGTGCGCCAGTTCGAGCTGCGCGCGCAACAGGCCGGCATTCCCAACGAAACCATCCTGGGCGCGCGCT
ACTGCCTGTGCACGGCGCTGGACGAGGCCGCCGCGCTCACGCCGTGGGGCGGGGGCGGCGTATGGTCGGC
GCACAGCCTGCTGGTGACGTTCCATAACGAAACCTGGGGCGGCGAGAAGTTCTTCCAGCTGCTGGCCAAG
CTGTCGCAGAACCCGGGCCAGCACCTGGATTTGCTGGAGCTGCTGTACTACTGCCTGCTGCTGGGCTTCG
AGGGCCGCTACCGCGTCATCGACAACGGCCGCACGCAGCTCGAGACCTTGCGCCAGCGCCTGCTGCGCAT
CCTGCGCGGCGCGCGCGGCGAGTATCCGCGCGCGCTCTCGCCGCATTGGCGCGACACGCCGGTGCAGCAG
GCGCTGCGCCGCCTGCCGGTGCCGCTGTGGGCCTACGGGGCGCTGGCGGCGGCGCTGGCGCTGGCGTTGT
TCTGGGGCCTGTCGTGGCGCCTGGGCGAACGCTCGGATGCCGTGTTCGCCGCGGTCGCGCGGCTCAAGCC
GCCCACGGTGCAGATCGCCCCGGCGCCGCGCCCGGCGCCCGCGCCCCGCCTGGCCGTGTTCCTGCAACCC
GAGGTGCGCGACCGCCTGGTGACGGTGCGCGACGAGGTCGATCGCAGCGTGGTGGTGCTGCGCGGCGACG
GGCTGTTCGAGTCGGGCGCGGTCGCGGTGCGCGACCGCTATGCGCCGGTGCTGGCGCGGGTGGCCGAGGC
GCTGGGCCAGACGCGCGGCGATATCGTGGTGCGCGGCTATACCGACAACGTTCCCATCCGCACGGCGCGC
TTTCCGTCCAACTGGCATCTGTCGCAGGCGCGCGCCGAGGCGGTCAAGGCGGTGATCGACGCGCGCCTGG
GCCAGGCCGGACGCGTGCGCGCAGAAGGGCGCGGCGAGGCCGATCCGCTGGCCCCCAATGACACCCCTGC
CGGACGCTCGGTCAACCGGCGGGTCGAAATTACCGTGATGGTGCCGCCGGCGCCGCATGCCCGCACGCCC
GAAGAAGGAGCCACGCCATGA