SecReT6
Protein ID: 410663446
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04400
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]969062..970636 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDK4KVX6
KEGG IDsaga:M5M_04400
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.20E-13, Aligned region: 30..97
Protein Sequence: 524 a.a.     [Download]
>gi|410663446|ref|YP_006915817.1| FHA domain-containing protein [Simiduia agarivorans SA1 = DSM 21679]
MDLILTIIADPDGTNMINHTKVFTQSGGAIGRADKNDWILPDPGRIVSSQHAAISFKDAHYWLTDTSTNG
LFLNDGTTPLGPGAPHKMVDGDIFAMGEYKVRVSIRPPKHDPNHIPDGLGTVDFLDESDKTQFSAGMAGA
LTAQKQASQFDDLLDSPSTPAHSQSQQWGFVNQEEASTPSHEAISDPMALFSSPTPTPGNSDWDDDWWKE
GSTADNAVATSHAVQTPHIVKPVPQPSSPPAAIPTSALQAAAGRQPMTGQSMEHSQAATLSQEANPFAAS
RQLLDGAAPPPTQPVPPAKPVQQSSAPVTTNPQASQAQRKVADAGAAVSIAQALGLTDLPAAAQVNIPTH
AVGIIRETVNRLIDLLRARNTIKNELRVQRTMIQTTDNNPLKFSANEDDALRTLFGQNTSAFLSPVAAVQ
DSFDDLSDHQVAVLAGTRAAYKAMLNHFAPDRLASRFGQSGSLLASKGAKNWAAYCEHYKELLRDTETTY
DDLFGEEFAAAYEKQLTDLKNARALSKRNRSTSA
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|409101470|ref|NC_018868.1|:969062-970636 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGGATTTAATACTGACGATCATCGCCGATCCCGACGGCACCAACATGATAAACCACACCAAGGTATTCA
CTCAGTCCGGTGGCGCCATAGGACGGGCGGATAAAAATGATTGGATTCTGCCCGACCCAGGTCGCATAGT
CTCATCCCAACATGCTGCCATCAGCTTCAAAGATGCTCACTACTGGCTTACAGACACAAGCACTAACGGG
CTCTTTCTGAACGATGGTACCACCCCTCTTGGGCCAGGCGCGCCGCATAAAATGGTAGATGGCGATATCT
TCGCAATGGGTGAATACAAGGTGCGTGTCAGCATACGCCCGCCGAAACACGACCCTAACCACATTCCCGA
TGGTCTTGGAACGGTTGACTTTTTAGATGAATCAGACAAAACGCAATTCAGCGCGGGCATGGCAGGAGCC
CTCACCGCACAAAAGCAAGCGAGCCAATTTGACGACCTGCTAGATTCACCGTCAACGCCAGCACATAGTC
AATCTCAACAATGGGGCTTTGTTAATCAGGAAGAGGCCAGCACACCAAGCCATGAGGCAATAAGTGACCC
AATGGCCTTATTCAGCTCCCCAACGCCCACACCAGGAAACTCGGATTGGGACGATGACTGGTGGAAAGAA
GGCAGCACTGCCGACAATGCGGTGGCGACTTCACACGCAGTTCAGACACCGCACATCGTTAAGCCCGTCC
CGCAGCCGTCGTCCCCACCTGCCGCCATACCAACAAGCGCTTTGCAGGCCGCCGCCGGGCGGCAACCCAT
GACCGGACAATCGATGGAACACAGCCAGGCTGCCACACTCAGCCAGGAAGCCAACCCTTTTGCGGCGTCG
CGCCAATTACTTGATGGTGCCGCGCCGCCCCCTACCCAACCGGTGCCGCCAGCAAAACCTGTTCAGCAGT
CATCCGCCCCGGTAACCACAAATCCGCAAGCCAGCCAGGCCCAGCGAAAAGTGGCAGACGCTGGCGCTGC
GGTGAGTATCGCGCAGGCACTTGGGCTCACCGATCTACCCGCTGCCGCTCAAGTCAATATTCCGACCCAT
GCAGTCGGCATTATCCGGGAGACGGTAAATCGGCTTATTGATTTACTCAGAGCCCGTAACACCATTAAAA
ATGAACTGCGCGTTCAGCGCACGATGATTCAGACCACCGACAATAACCCGTTAAAATTTTCGGCCAATGA
AGATGACGCCCTGAGAACACTTTTCGGTCAGAACACGTCAGCATTTCTAAGCCCGGTTGCTGCAGTTCAA
GACAGCTTCGACGATCTATCAGATCATCAGGTGGCTGTCCTGGCAGGAACACGGGCGGCCTACAAAGCAA
TGCTCAATCATTTTGCACCTGATCGACTGGCATCGCGTTTTGGTCAATCCGGATCGCTTTTGGCCAGTAA
AGGCGCCAAAAACTGGGCAGCCTATTGCGAACACTACAAAGAACTTTTGCGCGACACAGAGACCACGTAC
GACGACCTGTTTGGCGAGGAGTTTGCTGCTGCTTACGAAAAGCAGCTGACCGACCTTAAAAACGCACGCG
CATTGTCTAAACGCAATCGCAGTACATCCGCATAA