SecReT6
Protein ID: 410663447
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04405
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]970710..971159 [+]
Producthypothetical protein
NoteTssJ
UniProt IDK4KJC2
KEGG IDsaga:M5M_04405
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.10E-27, Aligned region: 2..136
Protein Sequence: 149 a.a.     [Download]
>gi|410663447|ref|YP_006915818.1| hypothetical protein M5M_04405 [Simiduia agarivorans SA1 = DSM 21679]
MIVSGCQTTRETLNLDTNAEVHLYAGEHINPDQDSRASPLVIRLFKLADDRQFGREDFLNLYENAENRLG
KDLLDTIVLKELAPGEHRVENLSLTPEVAYIGVLAEFVQYQDASAVTIFPITAHTSNEIHLQIEKLALKA
GKPIKKSRR
 
Nucleotide Sequence: 450 bp     [Download]
>gi|409101470|ref|NC_018868.1|:970710-971159 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
TTGATCGTGTCGGGCTGTCAAACCACCCGCGAAACGCTCAACTTGGACACTAACGCAGAGGTCCACTTAT
ACGCAGGTGAGCATATAAACCCAGACCAGGACAGCCGTGCCTCACCACTGGTTATCCGACTTTTCAAACT
GGCGGATGATCGTCAATTTGGCCGGGAAGATTTTTTAAACCTTTATGAAAACGCGGAAAATCGATTAGGT
AAGGATCTACTGGATACGATTGTGCTTAAGGAATTGGCGCCTGGTGAGCACCGCGTTGAAAACCTGTCTC
TGACCCCTGAAGTGGCCTACATTGGCGTTCTCGCTGAGTTCGTCCAATACCAGGACGCCAGCGCAGTAAC
TATATTCCCGATCACGGCACATACTAGCAACGAAATTCATCTGCAAATTGAAAAACTCGCGCTGAAAGCT
GGTAAACCCATCAAAAAATCTCGTCGATAA