SecReT6
Protein ID: 410663448
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04410
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]971193..972527 [+]
Producthypothetical protein
NoteTssK
UniProt IDK4KG71
KEGG IDsaga:M5M_04410
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-147, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|410663448|ref|YP_006915819.1| hypothetical protein M5M_04410 [Simiduia agarivorans SA1 = DSM 21679]
MSAMNKVIWSEGMFLRPQHFQQQDRYWERFIEGRLASFTEHSWGIHSLSIDAEPLTLGKLSLTEIKAVFP
DGTPYLAPDIEMPPPILEIPDNTQDLTIFLCVPLKRPGSQDSIRSEEDLPQARYQTYNYDIRNSTSQSSE
PARIQIGKLRVCLKTGNDDLSGYASIPVARVIERMPDKPVKLDRDFIPPVVRCSASLNLNSYLQEVAGLL
KQRGDALGNRLADSGRAGSAEIADYMLLQVINRFEPQIRQFIDEDHLHPYNLYTSLIQLAGELATFTASE
KRAPQLSPYRHDDLRSTYGDLFGALRQSLSTVLEQTATPLALVERKYGIHVAPITDPSMMVSSSFVLAVK
ADVQTELLRSRFPTQAKIAPVETIRELITTQMPGVKIRALPVAPRQIPYHAGFIYFELEKSGAVWQSFQR
SGGFAVHLGANFPGLAMELWAIRN
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|409101470|ref|NC_018868.1|:971193-972527 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGTCGGCAATGAATAAAGTTATCTGGTCGGAGGGAATGTTTCTCAGGCCACAGCACTTTCAGCAACAGG
ATCGTTACTGGGAGCGATTTATTGAAGGTCGATTAGCCAGCTTCACGGAGCACAGCTGGGGCATACACAG
CCTGAGCATCGATGCCGAACCATTGACGTTAGGCAAGCTGTCATTGACTGAAATTAAAGCAGTGTTTCCG
GATGGCACCCCTTACCTGGCACCGGATATAGAAATGCCGCCACCGATTCTGGAGATTCCCGACAATACTC
AGGATCTCACCATATTCCTTTGCGTTCCCCTAAAACGTCCGGGCAGCCAGGACTCTATTCGCTCAGAGGA
AGACTTGCCACAGGCACGTTATCAGACATACAACTACGACATCCGCAACAGCACCTCGCAGTCGAGCGAA
CCAGCCCGGATTCAGATTGGCAAGCTCCGGGTCTGCCTGAAAACCGGCAACGACGATTTGAGCGGTTATG
CCAGCATTCCGGTCGCACGCGTTATAGAACGAATGCCGGACAAGCCGGTAAAGCTGGACCGGGATTTTAT
CCCGCCGGTGGTCCGTTGCAGTGCATCGCTCAATCTCAATAGCTACCTACAAGAGGTGGCCGGCCTGCTC
AAACAAAGGGGTGACGCACTGGGAAACCGACTGGCGGATAGCGGCCGCGCCGGAAGCGCGGAGATTGCTG
ACTATATGTTACTGCAGGTAATTAACCGATTTGAACCGCAAATCCGGCAGTTTATCGACGAGGATCACCT
GCACCCCTATAACCTCTACACGAGCCTGATTCAATTGGCTGGCGAGTTAGCAACCTTCACCGCCAGCGAA
AAACGTGCACCTCAACTGTCGCCGTACAGGCATGACGATCTGCGCAGCACTTATGGCGATCTGTTTGGCG
CTTTGCGTCAGTCGCTCAGCACAGTTTTGGAACAAACTGCAACGCCGCTCGCGCTGGTTGAACGGAAATA
CGGAATACATGTCGCCCCCATCACTGATCCTTCAATGATGGTGAGCAGCTCATTTGTACTGGCAGTCAAA
GCTGATGTCCAAACTGAGCTGCTTCGGTCACGCTTCCCAACTCAGGCCAAGATTGCACCCGTTGAAACCA
TTCGGGAATTAATTACAACACAGATGCCCGGCGTGAAGATACGCGCACTACCGGTGGCGCCAAGACAAAT
TCCGTACCATGCAGGCTTTATCTATTTTGAGCTGGAAAAATCAGGGGCTGTCTGGCAGAGCTTCCAACGT
TCAGGTGGATTCGCAGTTCATCTGGGGGCGAACTTCCCTGGACTGGCAATGGAACTCTGGGCGATAAGGA
ACTAA