SecReT6
Protein ID: 410663449
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04415
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]972531..973352 [+]
Producthypothetical protein
NoteTssL
UniProt IDH8YHZ9
KEGG IDsaga:M5M_04415
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.50E-74, Aligned region: 41..246
Protein Sequence: 273 a.a.     [Download]
>gi|410663449|ref|YP_006915820.1| hypothetical protein M5M_04415 [Simiduia agarivorans SA1 = DSM 21679]
MQQDRTIMVPTPGARKGSAPRPQSYAGTPLAERVHIRKGLNPLVNTATTLLAVATKLRTTPQHSDVPDLH
RKLTEELKDFEQRARAQGCAEESVVTARYLLCTLVDEIVLNTPWGANSGWSQHSLLSLFHHETFGGEKCF
SILTRLLESPGRNLDLLELFYLCLSLGFEGKYRLAPRGHEQLEQVRDNLYQTLENQRPFPEQDLSPHWET
DTVKPKYRFDLIPLWVIAATFGAILLLSYSGLRWWLHDTTHPVAADIESRIALDSTIINQQPQ
 
Nucleotide Sequence: 822 bp     [Download]
>gi|409101470|ref|NC_018868.1|:972531-973352 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGCAACAAGACCGTACTATCATGGTGCCCACGCCCGGTGCACGCAAAGGCTCAGCACCCAGACCGCAAT
CCTATGCCGGCACACCTTTGGCCGAACGGGTTCATATTCGCAAAGGTCTTAATCCATTGGTGAATACTGC
AACCACATTACTCGCAGTGGCTACCAAACTTCGTACGACCCCACAGCATTCAGATGTCCCTGATCTGCAC
CGTAAACTGACCGAAGAACTCAAAGACTTTGAACAAAGGGCCCGGGCACAGGGGTGCGCAGAGGAATCCG
TCGTTACCGCTCGTTACTTGCTCTGCACGCTGGTGGACGAAATCGTCCTCAATACACCATGGGGCGCCAA
TAGCGGGTGGAGCCAACACTCATTGCTCAGCCTGTTTCACCACGAAACTTTCGGTGGCGAGAAGTGCTTT
TCCATCCTGACGCGATTACTGGAAAGCCCTGGGCGAAACCTGGATCTTCTGGAATTATTTTATCTTTGCC
TGAGCCTTGGATTTGAAGGTAAATATCGCCTGGCACCTCGTGGTCACGAGCAACTGGAACAGGTAAGAGA
CAACCTATACCAGACGCTGGAAAACCAACGACCATTTCCAGAGCAAGATCTATCCCCTCACTGGGAAACA
GACACCGTTAAACCCAAATACCGGTTTGATCTTATCCCGTTGTGGGTCATTGCAGCTACCTTCGGCGCAA
TACTACTGCTTAGCTACTCCGGCCTGCGGTGGTGGCTGCATGACACTACGCATCCAGTTGCGGCAGATAT
CGAAAGCCGGATAGCACTGGATTCAACCATTATTAACCAACAACCACAGTAA