SecReT6
Protein ID: 410663452
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04430
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]977800..979041 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDK4KJC5
KEGG IDsaga:M5M_04430
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.50E-24, Aligned region: 65..125
Protein Sequence: 413 a.a.     [Download]
>gi|410663452|ref|YP_006915823.1| type VI secretion-associated protein, ImpA family [Simiduia agarivorans SA1 = DSM 21679]
MSMEHVIDLDSLLTPISENEPQGSDLRADRSPNSLYYAIKDARNNARAAERSAMFDEDVDLMSPWKQVAD
LAPAILRETSKDLEVSCWYTEALIRLHGLSGLRDGLQLIKKLIEDHWEGLYPQPDEDGIETKVAPLTGLN
GDGGEGTLLAPLRNMPITLEEAGGAFSLWQYQQARDADRIVDEDEKVSRFDSLGYSLKSISDTIAATAVP
QAVSVVETLEECLDLFKSSQALLRSHCDHEAPPSSNISNLLEELLRTARFIYKEKLEAAQVAQEATQNAA
AESESADAAGTSGLPVTGISAPSGAISDREDALKRLETVAEYFRRYEPHSPIGPGLERLATWGRMTVAEL
MMELLPEDSAKGIFSQLTGVKLDGSDTATYIAPPKAAAPQAANPPSQAAPAAEAEQNEASMGW
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|409101470|ref|NC_018868.1|:977800-979041 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGTCTATGGAGCACGTAATAGATCTCGACAGTTTGCTCACGCCCATCAGTGAGAACGAGCCTCAAGGTT
CAGATTTACGCGCAGATCGCTCGCCCAACTCCCTTTACTATGCCATCAAAGACGCGCGTAACAACGCCCG
CGCGGCTGAACGCTCAGCTATGTTTGATGAAGACGTAGATCTGATGTCCCCCTGGAAGCAGGTCGCTGAC
CTGGCCCCCGCAATTCTCCGCGAAACAAGTAAGGATCTGGAGGTAAGTTGCTGGTACACCGAGGCATTGA
TCCGCCTGCACGGTTTAAGCGGCCTGCGCGACGGCTTACAACTGATCAAAAAGCTGATCGAAGATCATTG
GGAGGGCCTCTATCCGCAACCCGATGAGGATGGGATAGAAACTAAGGTCGCCCCCTTAACCGGCCTCAAT
GGCGATGGCGGTGAAGGCACGCTGCTCGCGCCACTCAGAAACATGCCGATTACACTGGAAGAAGCCGGAG
GCGCTTTTTCACTGTGGCAATACCAGCAAGCGCGTGATGCGGATCGCATTGTGGATGAGGACGAAAAAGT
CAGTCGTTTTGACAGCCTCGGTTATAGCCTGAAGAGTATCAGCGATACCATCGCCGCCACCGCTGTGCCG
CAAGCAGTCAGTGTGGTCGAAACTCTCGAAGAATGTCTTGACCTGTTCAAATCCTCACAGGCTTTACTGC
GCAGCCACTGCGACCATGAGGCGCCGCCCAGCTCAAATATTTCCAACTTACTGGAAGAGCTTCTGCGCAC
GGCGCGATTCATCTACAAAGAAAAACTCGAAGCCGCACAGGTAGCACAGGAAGCGACCCAAAATGCTGCT
GCAGAAAGCGAAAGTGCGGACGCAGCCGGCACAAGCGGATTACCCGTCACGGGCATTAGCGCCCCTTCCG
GTGCCATCAGCGACCGTGAAGATGCTCTTAAGCGTCTGGAAACCGTTGCCGAGTACTTCCGACGTTATGA
ACCACACTCCCCCATTGGCCCTGGGCTTGAGCGGCTGGCAACATGGGGCCGTATGACCGTCGCGGAACTC
ATGATGGAGCTCCTGCCAGAAGATTCGGCCAAAGGTATTTTTTCTCAACTCACCGGGGTCAAACTCGATG
GGTCAGATACGGCAACTTATATCGCTCCGCCCAAAGCGGCTGCGCCCCAAGCTGCCAACCCACCCAGTCA
GGCGGCACCTGCTGCCGAAGCTGAACAAAACGAAGCAAGTATGGGCTGGTAG