SecReT6
Protein ID: 410663453
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04435
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]979090..979608 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDK4KG75
KEGG IDsaga:M5M_04435
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-60, Aligned region: 9..163
Protein Sequence: 172 a.a.     [Download]
>gi|410663453|ref|YP_006915824.1| type VI secretion protein [Simiduia agarivorans SA1 = DSM 21679]
MSESIHNKLKRVRKPRVHITYDVETNGAEVKKELPFVVGVMGDYSGDNAESRKALKDRKFVQIDRDNFNE
AMAKVNPKLELQVENTLAGDGSKMGVNLDFKSMDSFSPEAIVDQVEPLKQLLEARNKLRDLLSKADRSEE
LEKVLEEILKNADNVTDISKELGISEEAEKGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|409101470|ref|NC_018868.1|:979090-979608 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGTCAGAAAGTATTCACAATAAACTGAAGCGTGTACGCAAGCCACGCGTTCATATCACCTACGACGTAG
AGACCAATGGCGCAGAAGTCAAAAAAGAACTGCCTTTTGTAGTTGGTGTAATGGGCGACTACTCAGGAGA
CAACGCCGAGTCCCGCAAAGCGTTGAAAGACCGTAAGTTTGTTCAAATTGATCGCGACAACTTCAACGAA
GCCATGGCCAAGGTCAACCCAAAGCTTGAACTCCAGGTGGAAAACACGCTGGCCGGCGATGGCAGCAAAA
TGGGCGTCAACCTGGACTTCAAAAGCATGGATAGCTTCAGCCCAGAAGCCATTGTCGACCAGGTGGAGCC
TTTAAAACAGTTACTGGAGGCTCGCAATAAACTGCGGGACCTGCTGAGCAAAGCTGATCGATCCGAAGAG
CTTGAAAAGGTGTTGGAAGAAATCCTTAAGAACGCCGATAACGTTACTGACATTTCCAAAGAGCTTGGCA
TTTCTGAAGAGGCCGAAAAGGGAGAGTAA