SecReT6
Protein ID: 410663454
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04440
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]979611..981098 [+]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDK4KIS5
KEGG IDsaga:M5M_04440
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-190, Aligned region: 63..492
Protein Sequence: 495 a.a.     [Download]
>gi|410663454|ref|YP_006915825.1| type VI secretion protein, EvpB/family [Simiduia agarivorans SA1 = DSM 21679]
MSTEAVVENAAAEEAGSASLLEQALSHTKQTSREEAQDLLSNLTKQVMQGTVTWDKNLTKTITAAVYAID
VAMSKQLSAILHQEKLQKLEGSWRGLNHLVMNSETGKTLKIRMLNLSKRELFRDLDKAVEFDQSQIFKKM
YEEEFGTAGGEPYGAMIGDFEFSNHPEDIELLTKMSNVAAAGFCPFISAAGAEMMGFDSFTELSKPRDLG
AIFESAEYIKWRSFRDSDDSRFVTLVMPRVLSRLPYGASTKPVESFNFEEFDQDASGMSKAAEHDQYCWM
NAAYVMGATLTKAFAENSWCTAIRGAEGGGKVEGLPTHLFKSDDGDTDIKCPTEIGITDRREAELSAQGF
LPLCHYKNTDYSVFFGAQTAQKPKKYDNPDATANASISARLPYLMATSRIAHYLKVMARDKVGSFMEASD
CERWLNKWIAQYTNSNPEASAEMKAKYPLAEARVEVKEIPGQPGSYSAVAYLKPWLQMEELTTSMRMVAN
IPTPS
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|409101470|ref|NC_018868.1|:979611-981098 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGAGCACTGAAGCCGTAGTTGAAAATGCAGCCGCTGAGGAAGCGGGCTCCGCCAGTTTGCTTGAGCAAG
CACTCAGCCATACCAAACAGACGTCTCGCGAAGAAGCGCAAGACCTGCTCTCAAACCTGACCAAGCAGGT
CATGCAGGGCACCGTTACCTGGGATAAGAATCTCACTAAAACCATTACCGCAGCCGTCTATGCCATCGAC
GTGGCCATGTCCAAACAGCTGTCCGCCATTCTGCACCAGGAAAAACTCCAAAAGCTGGAAGGTTCCTGGC
GCGGCCTGAATCATCTTGTGATGAATAGCGAAACAGGCAAGACACTCAAAATTCGTATGCTTAACCTGTC
AAAGCGCGAGCTGTTCCGCGATCTGGACAAGGCCGTTGAGTTTGATCAAAGCCAGATTTTCAAAAAGATG
TACGAGGAAGAGTTCGGCACGGCTGGCGGTGAGCCCTATGGTGCCATGATCGGGGACTTTGAATTCAGCA
ATCACCCCGAAGACATCGAACTCCTGACCAAAATGTCCAATGTTGCAGCTGCCGGTTTCTGCCCATTCAT
TTCGGCCGCAGGCGCAGAGATGATGGGTTTTGACAGCTTCACCGAACTGTCCAAACCACGTGACCTGGGT
GCGATCTTTGAGTCGGCTGAATACATCAAATGGCGCTCATTCCGCGACAGCGATGACTCGCGCTTTGTTA
CTCTGGTAATGCCGCGGGTATTATCCCGCCTGCCATATGGCGCTTCTACCAAGCCGGTGGAATCATTCAA
TTTTGAGGAGTTTGATCAGGATGCGTCAGGCATGTCCAAGGCTGCCGAGCACGATCAATACTGTTGGATG
AATGCGGCCTACGTTATGGGAGCAACACTCACCAAAGCGTTTGCAGAAAACTCCTGGTGTACCGCTATTC
GCGGTGCAGAAGGTGGCGGCAAGGTCGAAGGCCTGCCTACCCATCTGTTCAAAAGCGACGATGGCGATAC
AGATATCAAGTGTCCAACTGAAATTGGTATTACCGATCGCCGTGAAGCCGAGCTGTCTGCGCAAGGGTTC
CTGCCACTGTGTCACTACAAAAACACTGACTACTCGGTTTTCTTCGGCGCACAGACCGCCCAGAAGCCAA
AGAAATATGACAACCCTGATGCTACGGCCAATGCGTCCATTTCAGCACGCCTGCCCTACCTGATGGCCAC
TTCCCGTATAGCCCATTACCTGAAAGTAATGGCACGGGACAAAGTTGGCTCATTCATGGAGGCAAGCGAC
TGCGAGCGTTGGCTCAACAAATGGATCGCGCAATATACAAACTCCAACCCTGAAGCTTCTGCCGAAATGA
AAGCCAAATATCCATTGGCCGAGGCAAGAGTGGAGGTCAAAGAGATTCCTGGCCAGCCAGGCTCATACAG
CGCTGTTGCCTACCTTAAACCATGGTTGCAAATGGAAGAGCTGACCACCTCCATGCGTATGGTAGCCAAT
ATTCCAACGCCAAGCTAA