SecReT6
Protein ID: 410663455
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04445
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]981162..982673 [+]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDK4KGI1
KEGG IDsaga:M5M_04445
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.30E-154, Aligned region: 64..494
Protein Sequence: 503 a.a.     [Download]
>gi|410663455|ref|YP_006915826.1| type VI secretion protein, EvpB/family [Simiduia agarivorans SA1 = DSM 21679]
MSALTDAIDASKGQLARRDDIRIGLHPDQLSRFLATENSRDAFTHWLAVCPPGYRGARLRNYLNAQIAQI
DELICEQLNAIIHHGRFQALEARWLGLWQQVDASGIAENIKIKLLDVSWRELVRDIERAPDIDQSALFHL
VYNLEFGTPGGEPFGVLLGDYEVSHKPDADHPHDDIATLQGISRTAAAAFAPFICGASPRLFGLDSFQAL
GQAINISSVFEHKEYTRWHAMRSQDDTRFIALALPKVLMRRPYNRKFQSFRGIRFQEYHQAHSTDYLWGN
ACFAIGTVLIREFAEVGWFSHIRGVARDYHGGGLVSRFPCETFATDTHPARVRMNTQVLITDFQERELTE
HGLISLCHCYDTPYSAFNAMPSLQAPKRFNHKSADANARISAMLQQVMCASRFAQYIKVMIRDKVGAYIR
ADECERLLQQWLDRYTTGRDDLSWEMLARYPLREARVEVHEEPGNPGIYQSVIHLKTHYNVDQLVSELRL
TTSLSAGSVGTVK
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|409101470|ref|NC_018868.1|:981162-982673 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
TTGTCTGCACTTACCGACGCCATAGACGCCAGCAAAGGCCAGCTTGCCCGTAGGGACGACATTCGCATCG
GCCTTCACCCTGACCAGCTGAGCAGGTTTCTGGCAACGGAAAACAGTCGTGACGCATTCACCCATTGGCT
TGCAGTCTGCCCTCCCGGTTACCGTGGCGCACGTCTACGGAACTACCTCAATGCACAAATTGCCCAGATA
GACGAATTGATTTGCGAGCAACTGAACGCGATCATCCATCATGGACGCTTTCAGGCACTGGAGGCACGTT
GGCTTGGCCTTTGGCAGCAAGTAGATGCCAGTGGGATAGCCGAGAACATCAAAATCAAGCTACTGGACGT
GAGTTGGCGAGAATTGGTCAGGGATATAGAGCGCGCCCCTGACATTGATCAGTCAGCACTTTTTCATCTG
GTGTACAACCTCGAATTTGGCACCCCGGGTGGAGAGCCATTTGGCGTGTTACTGGGTGACTACGAGGTTA
GCCATAAACCAGATGCAGACCACCCTCACGACGACATTGCGACACTGCAGGGCATTAGTCGCACAGCGGC
TGCCGCGTTCGCGCCATTTATATGCGGAGCGTCACCCAGGCTATTCGGACTTGATAGCTTTCAGGCTCTG
GGCCAGGCAATCAACATCAGCTCAGTATTTGAACACAAAGAATACACCCGGTGGCACGCCATGCGTAGTC
AGGATGACACCCGATTCATCGCGCTTGCCTTACCCAAGGTATTGATGCGAAGGCCATACAACAGAAAGTT
CCAGTCTTTTCGCGGCATCCGGTTTCAGGAGTATCATCAGGCCCATAGCACCGACTACCTTTGGGGCAAC
GCCTGCTTTGCTATCGGAACCGTACTGATTCGGGAATTTGCGGAAGTGGGTTGGTTCTCGCACATCCGTG
GAGTCGCCAGAGATTATCACGGTGGCGGACTGGTGAGTCGTTTTCCGTGCGAGACCTTTGCCACGGATAC
ACATCCGGCAAGAGTCCGTATGAATACGCAGGTGCTGATAACGGATTTTCAGGAACGAGAGCTCACAGAA
CACGGGTTAATCAGCCTATGCCACTGTTACGACACACCCTATTCGGCTTTCAATGCCATGCCTTCACTTC
AGGCACCAAAACGATTTAACCACAAATCGGCGGACGCCAATGCCAGAATAAGCGCGATGTTACAGCAAGT
AATGTGTGCATCACGTTTTGCCCAATACATAAAGGTAATGATCCGTGACAAGGTGGGCGCCTACATTAGA
GCAGACGAGTGCGAACGCCTGTTACAGCAGTGGCTGGATCGCTATACCACCGGGCGTGATGATCTGTCGT
GGGAAATGCTTGCGCGTTATCCATTGCGGGAGGCGAGAGTCGAAGTACACGAAGAACCCGGCAATCCGGG
CATTTACCAAAGCGTCATTCACCTAAAAACCCACTACAACGTCGACCAACTGGTTTCCGAATTAAGACTG
ACTACATCTTTGTCAGCGGGATCTGTAGGTACAGTAAAGTAA