SecReT6
Protein ID: 410663456
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04450
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]982675..983148 [+]
Producthypothetical protein
NoteTssE
UniProt IDK4KVY6
KEGG IDsaga:M5M_04450
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.90E-23, Aligned region: 32..136
Protein Sequence: 157 a.a.     [Download]
>gi|410663456|ref|YP_006915827.1| hypothetical protein M5M_04450 [Simiduia agarivorans SA1 = DSM 21679]
MMQSADKKLLVPVLDRLMDQASINAQPHQLLKQLRESVRRDLEILFNTRFRCVSPPDGCNHLKSSLVNFG
LPDLSTINLAAQEQRKRFCRDIEKAILTFEPRIKTVKVQSDSKIDPENPFITFRIEAVLHTNPAPELIIF
DSALDLIKQSVDISEIQ
 
Nucleotide Sequence: 474 bp     [Download]
>gi|409101470|ref|NC_018868.1|:982675-983148 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGATGCAAAGTGCAGATAAAAAATTACTGGTTCCGGTGCTTGATCGATTAATGGATCAGGCGAGCATCA
ACGCACAGCCGCACCAGCTATTGAAACAATTACGAGAAAGCGTCCGAAGGGATCTTGAAATACTGTTTAA
CACCCGATTCCGTTGCGTTTCACCACCGGACGGATGCAATCACCTTAAATCCAGTCTTGTTAATTTCGGA
CTCCCAGACCTTTCTACGATCAATCTTGCCGCACAAGAACAACGCAAACGTTTTTGCAGGGATATTGAAA
AGGCGATACTCACCTTTGAACCCAGAATCAAGACCGTAAAGGTTCAATCCGATAGCAAGATTGACCCGGA
AAACCCGTTTATTACTTTCCGAATTGAAGCTGTACTTCACACCAACCCGGCACCCGAGCTTATTATCTTC
GATTCTGCCTTGGATTTAATAAAGCAAAGCGTTGATATTTCCGAGATTCAATGA