SecReT6
Protein ID: 410663457
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04455
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]983145..984974 [+]
Producthypothetical protein
NoteTssF
UniProt IDK4KJC9
KEGG IDsaga:M5M_04455
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.20E-194, Aligned region: 9..609
Protein Sequence: 609 a.a.     [Download]
>gi|410663457|ref|YP_006915828.1| hypothetical protein M5M_04455 [Simiduia agarivorans SA1 = DSM 21679]
MMSDELLLQYEKELAFINQSAGEFARKHPAAASRLQLSSDAVDDPLVGKLLSGFAYLNARVQQKLNDDFP
ELTDAILDTVYPHYLRPFPSACIVQFEPSAQLDEYIPVNRGLAIESESFQGQTCQFQTTADADLLPATVT
HASLMPRPFIAPGSNDIAGAGGVLKISLSTLSEKICFSDLGIHRLRFFLRGLPQHVNPLYDMLFTKTLRL
VLAKSETDPNPVFLPSTALRPVGFSEHEALIPYPQNAFEGYRILTEYFCFPEKFLFIDIVEIKEYVRNYN
NDLNLYIYFSESDTELENQINASMFSLGCTPAINLFKQTADPIPLNHTEYNYRIVPDARRADGLEVYSID
KVTATNSTGQSISYKPFYGLNHADSESQIAYWFTRRVPVVEGEHLNEPASEVDISLVNLNYSPFSITDHT
LEIQTTSSNRNLPKRLPTGGGQPYMQVIEDSLPAERISCVVTPTAAIRPPQREAGYWRLISHLNLNYLSL
SDGQGSTDALKEILRLYDFKNSSSTRKIIESIARLKTNSMTAPIQVDGMVSMCRGTAVHIEFDKLMLNGV
SVLLLASVLEHFLGLYCSINSFTRLKASFTGHDKEFKRWPPRAGEKTLL
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|409101470|ref|NC_018868.1|:983145-984974 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGATGAGTGACGAACTACTACTACAATATGAGAAAGAGCTGGCCTTTATAAATCAAAGTGCTGGAGAGT
TTGCCAGAAAACATCCTGCAGCTGCGTCTCGCCTTCAACTGTCATCTGATGCAGTGGATGACCCGCTGGT
AGGAAAACTACTATCAGGATTTGCCTACCTCAATGCCCGGGTACAACAAAAACTGAATGACGACTTTCCC
GAATTAACAGATGCAATTCTGGATACGGTTTACCCTCACTATTTACGACCGTTTCCCAGCGCCTGCATCG
TCCAATTCGAACCATCGGCCCAACTGGATGAGTACATCCCGGTTAACCGTGGGTTGGCGATAGAATCTGA
AAGTTTTCAGGGGCAGACATGTCAGTTTCAGACCACGGCAGACGCAGATCTGTTACCTGCCACCGTTACG
CACGCAAGCCTTATGCCGAGGCCTTTTATTGCACCAGGATCAAACGATATTGCCGGTGCAGGCGGCGTGT
TAAAAATTTCACTCTCTACATTGTCAGAAAAAATATGCTTTTCCGATCTAGGCATCCATCGATTGCGGTT
TTTCCTGAGAGGCCTGCCACAACATGTGAATCCGCTGTACGACATGCTATTTACCAAGACCTTAAGACTG
GTATTAGCTAAAAGCGAAACTGACCCCAACCCTGTATTCCTTCCGTCCACTGCACTCCGACCCGTGGGAT
TCAGCGAGCACGAGGCCTTAATCCCCTACCCGCAAAATGCGTTCGAAGGCTATAGAATACTCACCGAGTA
TTTCTGTTTTCCAGAAAAGTTCTTATTCATTGACATTGTGGAAATTAAGGAATATGTACGCAATTACAAC
AACGACCTGAATCTTTATATCTATTTTTCTGAATCAGACACTGAGCTTGAAAATCAGATCAACGCCAGCA
TGTTTTCGCTGGGTTGCACGCCCGCAATCAACCTGTTCAAACAAACAGCAGACCCAATTCCCTTAAACCA
TACCGAGTATAACTATCGGATTGTCCCGGATGCACGCAGAGCTGACGGACTTGAAGTGTATAGCATTGAT
AAAGTTACAGCCACGAACAGCACCGGACAAAGTATCAGCTACAAGCCGTTTTATGGACTGAACCACGCAG
ACAGCGAGTCTCAAATTGCTTATTGGTTCACCCGCAGGGTGCCTGTGGTTGAAGGCGAACACCTCAATGA
GCCCGCATCTGAAGTGGACATCAGTCTGGTGAACCTGAATTACTCGCCGTTTTCCATCACCGACCACACT
CTGGAGATTCAAACTACCAGCTCAAACCGGAACCTGCCAAAGAGATTACCAACAGGCGGAGGCCAACCCT
ATATGCAGGTGATCGAAGATAGCCTGCCTGCCGAGCGGATCAGCTGTGTAGTAACACCAACAGCAGCCAT
CCGCCCGCCTCAACGAGAAGCAGGATACTGGCGCCTGATCTCTCACCTTAACCTTAATTACCTTTCCCTG
TCAGACGGCCAGGGTTCAACGGATGCTTTGAAAGAAATACTGCGATTGTATGACTTCAAAAACTCTTCAT
CGACACGCAAAATTATTGAGTCTATCGCTCGGCTTAAAACCAACAGTATGACTGCGCCAATTCAGGTCGA
CGGCATGGTATCTATGTGTCGGGGCACCGCCGTGCACATAGAATTTGACAAATTAATGCTGAACGGCGTT
AGCGTACTCTTGCTTGCCAGTGTTTTAGAACACTTTCTTGGCCTTTATTGTTCCATTAATTCATTTACCC
GTCTAAAAGCGAGTTTCACCGGGCATGACAAGGAGTTTAAGCGATGGCCACCCCGCGCCGGCGAAAAGAC
CTTGCTCTGA