SecReT6
Protein ID: 410663458
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04460
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]984938..986080 [+]
Producthypothetical protein
NoteTssG
UniProt IDK4KG79
KEGG IDsaga:M5M_04460
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-79, Aligned region: 18..350
OGG_N [PF07934], Evalue: 0.00065, Aligned region: 207..250
Protein Sequence: 380 a.a.     [Download]
>gi|410663458|ref|YP_006915829.1| hypothetical protein M5M_04460 [Simiduia agarivorans SA1 = DSM 21679]
MATPRRRKDLALIDQLKQEPHRFEFFQAVRILETASAQDHSQQYARAPVAALAQPGKEAIRFTCSEKLHF
IGEDILSIGTEPNGEESASGEQQIRWLMNVSFFGLAGAQGVLPYRFSEIIQQEQKSKNTALKDFFDLFNH
RSTSLFHQAWHKYRLPVNYERARQSGKSHKDLFTNAILSLAGLGTSELHYRLPFPDEMIAGLTSGFARQT
TTASDLKGMIRHAFGLDVDISQFQGQWQPLDPEVACRLPDEETGLGINNQLGVNTVIGSYCYHAQSKFSV
VIAPLPYKRFMELAPGTRKLEALKSMIKLAVGTELEFDIAITTTQSKVPPCRLVQEDDYQPTLGWNTHLH
ADKIDAIESIDIHLSQSIEQPEEGLQLANT
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|409101470|ref|NC_018868.1|:984938-986080 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGGCCACCCCGCGCCGGCGAAAAGACCTTGCTCTGATCGATCAGTTAAAACAGGAACCTCATCGCTTCG
AATTTTTTCAGGCGGTAAGAATTCTTGAAACGGCCAGTGCTCAGGATCACTCCCAGCAATATGCCAGGGC
GCCGGTAGCTGCATTGGCTCAGCCCGGCAAGGAAGCCATTCGCTTCACCTGCTCTGAAAAACTGCACTTT
ATCGGGGAGGACATTCTTTCCATCGGAACTGAACCCAATGGGGAGGAGTCTGCTTCTGGGGAGCAACAGA
TACGCTGGCTGATGAACGTAAGCTTTTTTGGCTTAGCTGGCGCTCAAGGTGTCCTGCCCTATCGATTCAG
CGAAATTATTCAGCAAGAACAAAAAAGTAAAAATACCGCGCTTAAGGATTTTTTTGACCTTTTCAATCAC
CGTTCCACATCTCTGTTTCATCAGGCCTGGCACAAATACCGCCTACCAGTAAACTATGAACGTGCTCGAC
AGTCAGGTAAATCTCACAAAGATCTATTTACCAATGCAATACTGAGCCTGGCTGGACTGGGCACATCGGA
GCTCCATTACCGACTACCCTTCCCGGACGAAATGATTGCCGGCCTTACATCCGGCTTCGCGCGTCAAACG
ACTACGGCCAGCGATTTAAAGGGCATGATCCGACATGCGTTTGGACTGGATGTCGACATCAGTCAATTTC
AGGGTCAATGGCAACCTTTAGATCCGGAGGTGGCGTGCCGCTTACCCGATGAAGAAACGGGTTTGGGGAT
CAACAATCAATTGGGTGTCAATACAGTCATCGGCAGCTATTGTTATCACGCGCAAAGCAAGTTTTCAGTA
GTGATAGCGCCACTCCCATACAAGCGTTTCATGGAACTGGCCCCCGGCACGCGCAAGCTGGAAGCCCTGA
AGTCAATGATCAAGCTTGCAGTAGGAACAGAACTTGAATTTGACATTGCCATAACCACTACACAAAGCAA
AGTTCCACCTTGCAGGCTAGTACAAGAAGACGATTATCAACCCACCCTGGGATGGAATACCCATTTACAC
GCGGACAAGATTGACGCCATCGAGTCCATCGACATCCACCTGTCTCAATCCATCGAACAGCCAGAAGAAG
GCTTACAGCTAGCGAATACATAG