SecReT6
Protein ID: 410663459
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04465
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]986090..988741 [+]
Producttype VI secretion ATPase, ClpV1 family protein
NoteTssH
UniProt IDK4KIT0
KEGG IDsaga:M5M_04465
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.50E-41, Aligned region: 448..502
AAA_2 [PF07724], Evalue: 4.50E-41, Aligned region: 613..780
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 225..357
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 478..509
AAA [PF00004], Evalue: 3.90E-21, Aligned region: 619..746
AAA_5 [PF07728], Evalue: 3.80E-12, Aligned region: 225..247
AAA_5 [PF07728], Evalue: 3.80E-12, Aligned region: 619..738
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 448..505
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 592..639
AAA_16 [PF13191], Evalue: 6.00E-12, Aligned region: 680..712
ClpB_D2-small [PF10431], Evalue: 1.30E-11, Aligned region: 792..861
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 224..305
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 342..394
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 617..652
Sigma54_activat [PF00158], Evalue: 5.90E-06, Aligned region: 210..239
Sigma54_activat [PF00158], Evalue: 5.90E-06, Aligned region: 618..742
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 122..151
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 225..252
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 418..456
NACHT [PF05729], Evalue: 9.00E-05, Aligned region: 620..645
AAA_14 [PF13173], Evalue: 0.00016, Aligned region: 225..315
AAA_14 [PF13173], Evalue: 0.00016, Aligned region: 359..390
AAA_14 [PF13173], Evalue: 0.00016, Aligned region: 471..500
AAA_14 [PF13173], Evalue: 0.00016, Aligned region: 619..714
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 204..379
Arch_ATPase [PF01637], Evalue: 0.00026, Aligned region: 686..708
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 219..247
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 618..641
Zeta_toxin [PF06414], Evalue: 0.00042, Aligned region: 223..246
Zeta_toxin [PF06414], Evalue: 0.00042, Aligned region: 440..491
Zeta_toxin [PF06414], Evalue: 0.00042, Aligned region: 609..659
AAA_17 [PF13207], Evalue: 0.00047, Aligned region: 225..244
AAA_17 [PF13207], Evalue: 0.00047, Aligned region: 618..656
Clp_N [PF02861], Evalue: 0.00086, Aligned region: 28..76
Clp_N [PF02861], Evalue: 0.00086, Aligned region: 105..125
Clp_N [PF02861], Evalue: 0.00086, Aligned region: 312..322
AAA_25 [PF13481], Evalue: 0.0014, Aligned region: 225..286
AAA_25 [PF13481], Evalue: 0.0014, Aligned region: 438..488
AAA_25 [PF13481], Evalue: 0.0014, Aligned region: 615..643
AAA_25 [PF13481], Evalue: 0.0014, Aligned region: 681..702
TIP49 [PF06068], Evalue: 0.0015, Aligned region: 225..246
TIP49 [PF06068], Evalue: 0.0015, Aligned region: 273..305
TIP49 [PF06068], Evalue: 0.0015, Aligned region: 584..654
AAA_19 [PF13245], Evalue: 0.0025, Aligned region: 225..251
AAA_19 [PF13245], Evalue: 0.0025, Aligned region: 621..640
AAA_18 [PF13238], Evalue: 0.0089, Aligned region: 225..240
AAA_18 [PF13238], Evalue: 0.0089, Aligned region: 620..648
Protein Sequence: 883 a.a.     [Download]
>gi|410663459|ref|YP_006915830.1| type VI secretion ATPase, ClpV1 family protein [Simiduia agarivorans SA1 = DSM 21679]
MININLKSLVDRMAPALRDALEGAAGLSMAQSHYHVELEHWLIKILDNGQSDLQLVLEKFEIDVPQFARE
LGTAIGKFKTGSSRPAALSTSLVDAAKYAWMLASVEYGHGAITSGHLITAALLDGQLKDQLFTGCKELRS
IAPESLREAARALIGAGKELPRTESSRSAVDPAGIEVSKSPALDKYTINLTERAKKGEIDPVLGRDDEIR
QCIDILTRRRQNNPILTGEAGVGKTAVVEGFALRIAQGDVPEPLRNVAVRTLDLGLLQAGASVKGEFENR
LKSVIEEVRASLTPIILFIDEAHTMIGAGGKEGQGDAANLLKPALARGELRTIAATTWAEYKKYFERDPA
LTRRFQVVKVEEPDEATAIDMMRGIATSLTEHHKVRILDEAIIASVRLSHRYIPGRQLPDKSVSLLDTAC
ARVALSQSATPGAIEDCRRQIERAETTLKRLQREHAASNTQQEDIDLWHSQKQAAESRLSELEQQLVEET
ALIDEIKAIHQRIDAHFAGKEEDLISDDSFSNLQHSLVELSTKLKALQGNTPLMQAAVDEQAIAEVIANW
TGIPVGKMVDDEIRAVQSLATRLGERVIGQPHALEAVAQAVRTSRAGLTDPRKPVGVFLFCGTSGVGKTE
TALALADQLFGGEQNITTINMSEFKEEHKVSMLLGSPPGYVGYGEGGVLTEAARRKPYSVILLDEMEKAH
PGVQDIFYNLFDKGTIKDGEGRDIDFKNTVIIMTSNAGEDAIRAIFQQVEEKPEPDVLLDNIRPHLLRSF
KPAFLGRANVIAYYPRGSTTYLMKIAAINMRKIEHRVKSHYGAAFSYDEDVLLHIVARCQESDTGARNIE
NILNRTLLPTMAAECLEKLANGELIQKLHIGVTEEGDFTYQLS
 
Nucleotide Sequence: 2652 bp     [Download]
>gi|409101470|ref|NC_018868.1|:986090-988741 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGATCAACATCAATCTGAAATCATTGGTTGACCGGATGGCACCTGCGTTGCGGGATGCACTCGAAGGGG
CCGCCGGTCTGTCTATGGCGCAAAGTCACTACCATGTAGAGCTTGAACACTGGCTGATTAAAATTCTCGA
TAACGGCCAGTCCGACCTGCAATTGGTATTGGAAAAATTTGAAATCGACGTGCCACAGTTCGCACGCGAA
TTGGGCACGGCTATCGGAAAATTCAAAACCGGCAGCAGTCGACCTGCAGCACTGTCCACCAGTCTGGTGG
ATGCTGCCAAATATGCGTGGATGCTTGCATCTGTGGAATATGGCCACGGCGCTATCACCTCGGGCCATCT
GATCACTGCAGCATTGCTGGATGGGCAGCTCAAAGATCAATTGTTCACCGGCTGCAAAGAGTTACGCTCT
ATCGCTCCAGAATCATTAAGGGAGGCAGCTCGCGCGCTAATTGGTGCCGGTAAAGAGCTACCACGGACCG
AGTCCAGCAGGTCTGCTGTTGACCCTGCAGGTATCGAAGTCTCCAAATCGCCTGCGCTGGACAAATACAC
CATCAACCTCACAGAGCGCGCAAAAAAGGGAGAGATCGATCCTGTATTAGGACGTGACGATGAAATCAGG
CAATGCATCGATATCCTTACCCGCCGTCGCCAGAACAACCCAATCCTGACCGGTGAAGCCGGCGTTGGGA
AAACCGCCGTTGTAGAAGGCTTCGCCTTGCGCATTGCCCAAGGCGATGTACCTGAACCCCTCAGAAACGT
TGCGGTCCGAACACTCGATCTCGGGCTATTACAGGCAGGCGCAAGCGTTAAAGGTGAATTCGAAAATCGC
CTCAAGAGCGTCATTGAAGAAGTACGCGCTTCGCTAACCCCGATTATCCTGTTCATCGATGAAGCGCATA
CCATGATTGGTGCAGGCGGAAAAGAAGGTCAGGGCGATGCGGCAAACTTACTCAAGCCAGCACTGGCCCG
CGGCGAGTTACGCACCATTGCAGCCACAACCTGGGCGGAATACAAGAAGTATTTCGAACGGGATCCAGCC
CTGACCCGACGCTTTCAGGTGGTCAAGGTGGAAGAACCCGACGAGGCCACAGCTATCGATATGATGCGCG
GTATCGCCACAAGCCTTACAGAACATCATAAGGTCCGGATACTGGACGAAGCCATAATCGCATCGGTCAG
ATTATCCCATCGCTATATCCCCGGCAGGCAACTTCCAGACAAATCTGTCAGCTTACTGGATACCGCTTGT
GCCCGCGTTGCACTCAGCCAGTCTGCAACACCCGGCGCAATTGAAGATTGCCGTCGGCAGATAGAACGCG
CCGAAACCACGTTAAAACGCCTGCAAAGAGAACATGCGGCCAGTAACACTCAGCAAGAAGATATTGATCT
ATGGCATAGCCAAAAGCAGGCCGCCGAATCGCGATTGTCTGAACTCGAGCAGCAGTTAGTTGAAGAAACC
GCCCTAATTGATGAAATCAAAGCAATTCATCAACGCATCGATGCCCATTTTGCCGGTAAAGAAGAAGACT
TGATCAGCGATGACAGCTTCTCAAACCTGCAACACAGCCTGGTAGAGCTTTCCACTAAGCTCAAAGCTCT
GCAGGGCAACACCCCACTGATGCAAGCGGCCGTGGATGAGCAGGCCATCGCCGAAGTCATTGCGAATTGG
ACCGGTATTCCCGTTGGAAAAATGGTTGATGATGAAATACGCGCGGTCCAATCGCTCGCAACACGTCTGG
GTGAACGGGTAATCGGTCAACCCCATGCACTGGAGGCTGTAGCGCAAGCAGTCCGCACTTCTCGTGCCGG
CCTCACAGACCCACGCAAACCCGTGGGCGTGTTCCTGTTCTGTGGTACCAGTGGCGTCGGAAAAACTGAA
ACAGCCCTGGCATTGGCAGATCAGCTCTTTGGAGGTGAGCAAAATATTACGACGATTAACATGTCGGAAT
TCAAGGAAGAGCATAAAGTTTCTATGCTGCTAGGCTCTCCACCCGGTTACGTTGGCTATGGCGAAGGTGG
CGTACTCACAGAGGCAGCGCGTCGTAAACCCTATTCCGTTATTCTGTTGGATGAAATGGAAAAGGCACAC
CCCGGTGTACAGGATATTTTCTACAACCTGTTTGATAAGGGCACCATTAAAGACGGTGAAGGTCGTGACA
TTGACTTCAAAAATACTGTCATAATCATGACGTCAAATGCTGGTGAAGATGCAATTCGGGCTATTTTCCA
GCAAGTGGAAGAAAAACCTGAACCGGATGTACTTTTGGACAATATCCGCCCGCATTTATTGCGCAGCTTC
AAACCAGCGTTTTTGGGTCGAGCGAATGTCATCGCATATTACCCCCGTGGATCGACGACGTACCTGATGA
AGATTGCGGCAATTAACATGAGAAAGATTGAACATCGTGTCAAGAGTCATTACGGCGCAGCGTTCAGCTA
CGATGAAGATGTTCTGCTGCATATTGTCGCCCGCTGCCAGGAATCTGACACCGGCGCCCGAAATATCGAA
AACATTCTCAACCGGACATTGCTTCCTACGATGGCAGCCGAGTGTTTGGAAAAGCTTGCCAATGGTGAGC
TGATCCAAAAACTCCATATCGGTGTTACAGAGGAAGGTGATTTCACCTACCAGCTGAGCTGA