SecReT6
Protein ID: 410663463
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04485
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]990635..992521 [-]
Producthypothetical protein
NoteTssI
UniProt IDK4KG86
KEGG IDsaga:M5M_04485
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-57, Aligned region: 30..341
Phage_base_V [PF04717], Evalue: 8.20E-19, Aligned region: 391..463
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 515..531
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 526..550
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 558..574
Gp5_C [PF06715], Evalue: 2.10E-05, Aligned region: 606..625
DUF2345 [PF10106], Evalue: 0.00094, Aligned region: 494..600
Protein Sequence: 628 a.a.     [Download]
>gi|410663463|ref|YP_006915834.1| hypothetical protein M5M_04485 [Simiduia agarivorans SA1 = DSM 21679]
MANLTQKHRLIHVNSPLGADQLIATSLNGEESISGLFRYEIELWSENHAITQKDLVGKPLTLTLNRDGQE
QRRFIHGYVNQFAMLDVNAEGLRKYRAILVPGLWFASLGSNNRVFHNKTAKQIVEDVLGEYSKVVKLSLK
LNASYAVREYCVQFDETDFDFVSRLMAEEGIAYYFVHSEGSLELVVTDDAQGFYDLPDSVVEYDGGGSHP
AKSTIHAWSKQFAYHTGGFEFKDYNEFTPDKDHKLEIKTSNKLNDVAAYKLRTFGRYTFEQDADPKHKIT
DKTNRHRAKMAMESIESGHELADATSDCAAFCAGGRFELEHSLDTEKGKYLIVALSISAADGNGVVSGFQ
NQFRAVPVDIMPRPHPLRYQRKVNYPMVATVLEVKATGADSSQDAYTQLKVKFPWNSQQNSCWVRVQQAF
SGKNWGANFVPRIGQEVIVTYLNGDPDRPIVSGAVYNATNTGPNYTSTQSGWKTEWDGSAFNELRFDDKK
GAEEIFMEAGKDHNFIVHNDQKGKIENDQTIEVIKNRTLTVAEGNETHTVKKGDQTISIDSGNQALTIKK
GTQTIDVKGAVKITSKASIELKVGGSSIKLTPSGIEIKGTTLKAKGDATAEVKAGGMLTIKGSLTKIN
 
Nucleotide Sequence: 1887 bp     [Download]
>gi|409101470|ref|NC_018868.1|:c992521-990635 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGGCAAATCTCACGCAAAAGCACCGTTTAATTCACGTCAATTCCCCGCTGGGCGCCGACCAGCTTATCG
CAACATCCCTTAATGGCGAAGAATCGATATCTGGGCTGTTCCGCTATGAGATTGAATTGTGGTCTGAGAA
TCACGCGATCACCCAAAAAGATTTAGTGGGTAAGCCTTTGACGCTGACGTTAAACCGGGATGGGCAAGAA
CAGCGACGCTTCATTCATGGCTACGTAAACCAATTTGCGATGCTTGATGTGAATGCCGAAGGGCTGAGAA
AGTATCGTGCAATCCTGGTGCCAGGGCTCTGGTTCGCGTCACTCGGTAGCAATAACCGAGTTTTCCACAA
CAAGACCGCAAAGCAAATAGTGGAAGATGTTCTGGGCGAGTACAGCAAGGTCGTTAAGCTCAGTCTTAAA
CTCAATGCGAGTTATGCGGTGAGAGAATACTGCGTTCAGTTTGACGAAACCGACTTCGATTTTGTTTCAA
GATTGATGGCAGAGGAGGGGATTGCCTATTATTTTGTGCATTCCGAAGGCAGTCTCGAGCTGGTTGTCAC
AGACGATGCGCAAGGTTTCTACGATCTGCCTGATAGTGTTGTGGAATATGACGGTGGCGGTTCCCATCCA
GCGAAAAGCACTATTCACGCCTGGTCAAAACAATTTGCTTACCACACCGGTGGCTTTGAGTTTAAAGACT
ACAACGAATTTACACCCGACAAAGATCACAAGCTTGAAATCAAGACCAGTAATAAATTGAATGACGTAGC
AGCATACAAGCTGCGTACTTTTGGGCGTTATACTTTTGAGCAGGACGCAGATCCTAAACATAAAATAACA
GACAAAACCAACAGGCACCGGGCAAAGATGGCCATGGAGTCTATTGAAAGCGGTCATGAACTGGCGGATG
CGACCAGTGATTGCGCGGCATTCTGTGCAGGCGGGCGCTTCGAATTAGAGCATTCTCTGGATACGGAGAA
GGGTAAGTATCTCATCGTTGCCTTATCTATCAGTGCGGCTGATGGCAATGGCGTTGTGAGCGGTTTCCAA
AACCAATTTCGTGCGGTACCTGTTGATATCATGCCTCGTCCTCATCCTCTACGTTATCAGCGAAAGGTTA
ATTACCCTATGGTGGCAACGGTACTGGAGGTGAAGGCTACCGGCGCCGATAGCTCGCAAGATGCGTATAC
GCAACTGAAAGTTAAATTTCCTTGGAATAGCCAGCAAAACTCTTGTTGGGTAAGAGTCCAGCAAGCATTT
TCAGGTAAAAACTGGGGGGCAAACTTTGTTCCTCGGATTGGACAAGAGGTGATTGTGACCTACCTTAATG
GCGATCCTGATCGACCGATTGTCTCCGGTGCAGTCTATAACGCAACCAATACCGGGCCGAATTACACGTC
GACGCAGTCGGGGTGGAAGACAGAGTGGGACGGCAGCGCTTTTAATGAATTGCGGTTTGACGATAAAAAG
GGCGCCGAAGAGATATTTATGGAGGCGGGCAAGGATCACAACTTTATCGTCCATAATGACCAGAAAGGCA
AAATCGAGAATGACCAAACGATTGAAGTGATTAAAAACCGGACGCTAACAGTAGCCGAAGGGAATGAGAC
GCACACGGTTAAAAAAGGTGATCAGACGATCAGTATTGATAGTGGCAATCAGGCGCTGACGATTAAAAAG
GGTACGCAAACAATCGATGTCAAAGGTGCAGTAAAGATTACGTCCAAAGCCTCAATAGAATTGAAAGTGG
GAGGCTCTTCGATCAAGTTGACTCCTTCGGGAATTGAAATCAAAGGCACCACGCTGAAGGCAAAAGGTGA
TGCAACTGCTGAGGTGAAGGCGGGTGGAATGCTGACCATCAAAGGTAGTCTAACTAAAATTAACTGA