SecReT6
Protein ID: 410663464
SecReT6 ID711
T6SS typei5
Gene symbol-
Locus tagM5M_04490
StrainSimiduia agarivorans SA1 = DSM 21679
Repliconchromosome [GenBank: NC_018868] [Browse all T6SS(s) in this replicon]
Location [Strand]992648..993136 [-]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDK4KIT5
KEGG IDsaga:M5M_04490
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-29, Aligned region: 4..136
Protein Sequence: 162 a.a.     [Download]
>gi|410663464|ref|YP_006915835.1| hemolysin-coregulated protein [Simiduia agarivorans SA1 = DSM 21679]
MAIYMNFNGNSPAGNVTAEGYANWIELDNFHFGVGRAITMEAGAMANREATRPSLSEVTVTKPLDAASGG
LFKASVTGDEGVKVEIHVVQTGANKVEKYATYTLEDVIIASYSVSASTGGAPVESISLSFAKIEADLTHA
DKTNKNTKNMRVGYDLTKATPL
 
Nucleotide Sequence: 489 bp     [Download]
>gi|409101470|ref|NC_018868.1|:c993136-992648 Simiduia agarivorans SA1 = DSM 21679 chromosome, complete genome
ATGGCGATTTACATGAACTTCAATGGCAATTCACCCGCTGGCAACGTAACCGCAGAAGGTTACGCTAACT
GGATTGAGCTGGATAACTTCCACTTTGGCGTTGGCCGCGCAATCACCATGGAAGCCGGTGCAATGGCTAA
CCGTGAGGCGACCCGCCCAAGCCTGTCTGAAGTCACTGTGACTAAGCCGCTGGATGCCGCATCCGGTGGT
CTGTTCAAGGCTTCCGTAACTGGTGACGAAGGCGTGAAGGTAGAGATTCACGTGGTTCAAACCGGTGCGA
ACAAAGTTGAGAAGTACGCTACTTACACACTCGAAGATGTGATCATTGCCTCTTACAGCGTGTCTGCCAG
CACTGGTGGAGCTCCGGTTGAGTCGATCTCTCTGAGCTTCGCTAAAATTGAAGCGGATCTGACTCACGCA
GACAAGACCAACAAGAACACCAAAAATATGCGTGTTGGTTACGATCTCACCAAAGCTACACCTCTGTAA