SecReT6
Protein ID: 410684615
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10707
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]820709..823510 [-]
Productconserved hypothethical protein, Rhs element Vgr related protein
NoteTssI
UniProt IDD8NHI2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-64, Aligned region: 46..356
Phage_GPD [PF05954], Evalue: 2.00E-64, Aligned region: 607..627
DUF2345 [PF10106], Evalue: 1.70E-43, Aligned region: 667..817
T6SS_Vgr [PF13296], Evalue: 1.10E-32, Aligned region: 520..628
Phage_base_V [PF04717], Evalue: 1.40E-17, Aligned region: 416..502
Protein Sequence: 933 a.a.     [Download]
>gi|410684615|ref|YP_006060622.1| conserved hypothethical protein, Rhs element Vgr related protein [Ralstonia solanacearum CMR15]
MKSPFPLPAAVPQAVLGALLGQQTRQITLETALASDNLVVERFTAREAVSASCVLQVDCLSPLADLDTAR
LASQEATLRLMLADGSRRAWHGYVTDCAALGGNGGLARYRLSIGPWLDRLHSRRDCFAYQDKTALEIIED
LFADYPAAHYKLAVSQPCAKRSICCQYRETDYDFVMRLLAEEGLSLRIEHEQDDARRDGSAQSRHCVVIF
DNDAERPACAQPDIRFHRVDATEREDAIERFSQMRTVGTNAVTVTSWNYKALAATAAQATASDPGGELPT
LEAFDAAGPYRFADAQGAGRAARLRMQAHEGAYLRYLGQGSVRQLGPGQRFTLTQHFDTRHSQFVTLSVE
HEAANNLGADLARLLGTTDIESGRYRNRFVAVPAEAPIVPPYRHRPTAPEGQAATVIADDGAPLTTDRDH
RVRIRFPWLRAPAVNAFTEPAGGDRSQITAWVRVATASAGPNWGAHHLPRAGTQVLLTFIDGDIDRPLVT
MQLHNEQDALPWPAADAPLGQALSGWHSPSLGGDGYNQWVVDDHPAQLRMRLATATAGSQLNLGYVVSHG
PTGGERGDWRGTGAELRTDAWAVVRAGGGLLLTTTARAQAGGTLLDAKEARGQFLAAQRTAQRLSNAAAS
QQALPLAANEAFDPLTQALDPAQDGHYPNRVNGQDATQPNQAPVDKFAQPLLVTESPTSIALASQATTTV
YAGRHLHGTAQGDWHLVAGNVVAAAAARGVSLFAQRNGLRVIAEGGPVSIQAHTDALAVLADQAVTVTSS
TESIDILAQRNIVLRGGDSVIRMEGNAITFETTKLSVKGAGHPLIEPGGQAAELPALPVDAIPPTTILLE
HTYHDGQGLAGAKYFAKFADGSERQGVLDAQGRATLENVPPGNVQVSYGPMPGAFERKDKTPMPNHDPNP
SDDKIAELVDKYLSANASQNPSA
 
Nucleotide Sequence: 2802 bp     [Download]
>gi|410683947|ref|NC_017589.1|:c823510-820709 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGAAGTCACCGTTCCCCCTGCCGGCCGCCGTGCCGCAAGCCGTCCTGGGCGCGCTGCTCGGGCAGCAGA
CCCGCCAGATCACGCTGGAGACGGCGCTGGCCTCCGACAACCTGGTGGTGGAACGCTTCACGGCGCGCGA
GGCGGTGTCGGCATCGTGCGTGCTGCAGGTCGATTGCCTGAGCCCCCTGGCCGACCTGGATACCGCCAGG
CTGGCCTCGCAGGAGGCCACGCTGCGCCTGATGCTCGCCGACGGCAGCCGGCGCGCCTGGCACGGCTACG
TGACCGATTGCGCGGCCCTCGGCGGCAACGGCGGACTGGCGCGCTACCGCCTGAGTATCGGGCCCTGGCT
CGACCGCCTGCACAGCCGCCGCGACTGCTTCGCCTACCAGGACAAGACCGCGCTGGAGATCATCGAAGAC
CTCTTCGCCGATTACCCCGCCGCCCACTACAAGCTTGCCGTCAGCCAGCCGTGCGCCAAGCGCTCGATCT
GCTGCCAGTACCGCGAGACCGACTACGACTTCGTGATGCGCCTGCTGGCCGAGGAAGGCCTGTCGCTGCG
CATCGAGCACGAGCAAGACGACGCGCGGCGCGACGGCAGCGCGCAATCGCGCCACTGCGTGGTCATCTTC
GACAACGACGCCGAACGCCCCGCCTGCGCGCAGCCTGACATCCGCTTCCACCGCGTCGACGCCACCGAGC
GCGAGGACGCCATCGAGCGCTTCTCGCAGATGCGCACGGTCGGCACCAACGCCGTGACCGTCACCTCGTG
GAACTACAAAGCCCTGGCCGCCACCGCCGCCCAGGCCACCGCCAGCGACCCCGGCGGCGAACTGCCGACG
CTCGAAGCGTTCGACGCCGCCGGCCCCTACCGCTTTGCCGATGCCCAGGGCGCCGGCCGCGCCGCGCGCC
TGCGCATGCAGGCCCACGAAGGCGCCTACCTACGCTACCTCGGCCAGGGCAGCGTGCGCCAGCTCGGCCC
CGGCCAGCGCTTCACGCTCACCCAGCACTTCGACACCCGCCACAGCCAATTCGTCACGCTGTCGGTCGAG
CACGAGGCGGCCAACAACCTCGGCGCCGACCTCGCCCGGCTGCTCGGCACCACCGACATCGAATCGGGCC
GCTACCGCAACCGCTTCGTCGCCGTGCCGGCCGAGGCGCCGATCGTGCCGCCGTACCGCCACCGCCCCAC
GGCCCCCGAAGGCCAGGCCGCCACGGTCATCGCCGACGACGGCGCCCCGCTCACCACCGACCGCGACCAC
CGCGTGCGCATCCGCTTCCCGTGGCTGCGCGCGCCGGCGGTCAACGCCTTCACCGAGCCGGCCGGCGGCG
ACCGCTCGCAGATCACCGCCTGGGTGCGCGTGGCCACCGCATCGGCCGGCCCGAACTGGGGCGCGCATCA
CCTGCCGCGCGCCGGCACCCAGGTGCTGCTGACCTTCATCGACGGCGACATCGACCGGCCGCTGGTCACC
ATGCAGCTGCACAACGAACAGGACGCGCTGCCCTGGCCGGCCGCCGACGCGCCGCTCGGGCAGGCGCTAT
CGGGCTGGCACTCGCCGAGCTTGGGCGGGGACGGCTACAACCAGTGGGTGGTCGACGATCACCCCGCGCA
GCTGCGCATGCGGCTGGCCACCGCCACCGCCGGCAGCCAGCTCAACCTCGGCTACGTGGTCTCGCACGGC
CCGACCGGCGGCGAGCGCGGCGACTGGCGCGGCACCGGCGCGGAGCTGCGCACCGATGCGTGGGCGGTGG
TGCGCGCCGGCGGCGGCCTGCTGCTGACCACCACGGCCCGCGCGCAAGCCGGCGGCACGCTGCTCGACGC
AAAGGAAGCGCGCGGCCAGTTCCTCGCCGCCCAGCGCACCGCGCAGCGCCTGTCCAACGCGGCGGCCAGC
CAGCAGGCGCTGCCGCTGGCGGCCAACGAAGCCTTCGACCCGCTCACGCAAGCGCTTGACCCAGCCCAGG
ACGGGCACTACCCGAACCGCGTCAACGGCCAGGACGCGACCCAGCCGAACCAGGCGCCGGTCGACAAGTT
CGCCCAGCCGCTGCTGGTGACCGAATCGCCCACCAGCATCGCCCTGGCCTCGCAGGCCACCACCACGGTC
TACGCGGGGCGGCACCTGCATGGCACCGCGCAAGGCGACTGGCACTTGGTCGCCGGCAACGTCGTGGCAG
CCGCGGCGGCCCGGGGCGTGAGCCTGTTCGCGCAACGCAACGGCCTGCGCGTAATCGCCGAGGGCGGGCC
GGTGTCGATCCAGGCGCATACCGATGCGCTGGCGGTACTGGCGGATCAGGCCGTGACGGTGACCTCGTCT
ACCGAGTCGATCGACATCCTGGCGCAGCGGAACATCGTGCTGCGTGGCGGGGATTCGGTGATACGGATGG
AGGGGAATGCGATTACGTTCGAGACCACCAAGCTGAGTGTGAAGGGGGCGGGGCATCCGTTGATTGAGCC
TGGGGGGCAGGCGGCGGAATTGCCGGCGTTGCCGGTGGACGCGATCCCGCCGACAACGATCTTGCTCGAA
CACACATACCACGACGGCCAAGGTCTAGCCGGCGCGAAGTATTTCGCCAAGTTCGCCGATGGGTCGGAAC
GGCAAGGCGTGCTGGATGCGCAAGGGCGAGCAACGCTCGAGAACGTGCCGCCCGGCAATGTGCAAGTCAG
CTATGGTCCGATGCCGGGCGCTTTCGAGCGCAAGGACAAGACACCTATGCCCAATCACGATCCGAATCCA
TCGGACGACAAGATCGCCGAACTAGTCGACAAATACCTGTCGGCGAACGCCTCGCAAAACCCGTCCGCTT
AA