SecReT6
Protein ID: 410684616
SecReT6 ID784
T6SS typei4b
Gene symbol-
Locus tagCMR15_mp10708
StrainRalstonia solanacearum CMR15
Repliconplasmid CMR15_mp [GenBank: NC_017589] [Browse all T6SS(s) in this replicon]
Location [Strand]823569..824360 [-]
Productputative secretion system protein (EvpN-like)
NoteTssL
UniProt IDD8NHI3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.60E-57, Aligned region: 33..234
Protein Sequence: 263 a.a.     [Download]
>gi|410684616|ref|YP_006060623.1| putative secretion system protein (EvpN-like) [Ralstonia solanacearum CMR15]
MSATTTPSLFGGSAAPAGNAAADPRDSNTHVRTLLDLLYDGFFMLFQLRNGQQPTTAEDFLTRVRAFLED
FDRGAKRLNVSAEDVFDAKYAFCAAVDETILSSNFSIRTAWERRPLQLELFGEQLAGETFFIKLEELRAH
GAPRLQALEVFHMCLLLGFRGKYILEGPEKLAYLTARLGDEISAIKGKRAAFAPHWLLPDKVSHRLKRET
PLWIFGAVFALIALLGYIGLSSTLRGKTNETLEGYSQVIKLGPRFSHLTISLP
 
Nucleotide Sequence: 792 bp     [Download]
>gi|410683947|ref|NC_017589.1|:c824360-823569 Ralstonia solanacearum CMR15 plasmid CMR15_mp, complete genome
ATGAGCGCTACCACCACTCCCTCGCTGTTCGGCGGCTCGGCCGCCCCCGCCGGCAATGCAGCGGCCGATC
CGCGCGACTCCAACACGCACGTGCGCACGCTGCTGGACCTGCTCTACGACGGCTTCTTCATGCTCTTCCA
GCTGCGCAACGGCCAGCAGCCGACCACCGCGGAAGACTTCCTCACCCGCGTGCGTGCCTTCCTGGAAGAT
TTCGACCGCGGCGCCAAGCGGCTGAACGTGTCGGCCGAAGACGTGTTCGACGCCAAGTACGCGTTCTGCG
CCGCCGTGGACGAGACCATCCTGTCGTCCAACTTCTCCATCCGCACCGCCTGGGAACGCCGTCCGCTGCA
GCTCGAGCTGTTCGGCGAGCAGCTCGCCGGTGAAACGTTCTTCATCAAGCTGGAAGAACTGCGTGCCCAC
GGCGCGCCGCGCCTGCAAGCCCTGGAGGTCTTCCACATGTGCCTGCTGCTGGGCTTCCGCGGCAAGTACA
TCCTCGAAGGGCCGGAGAAGCTGGCCTACCTGACCGCCCGCCTGGGCGACGAGATCTCCGCCATCAAGGG
CAAGCGCGCGGCCTTCGCGCCGCACTGGCTGCTGCCGGACAAGGTGTCGCACCGGCTCAAGCGCGAAACG
CCGCTGTGGATCTTCGGCGCGGTCTTCGCGCTGATCGCGCTGCTGGGGTACATCGGCCTGTCGTCCACGC
TGCGCGGGAAGACGAACGAAACGCTGGAAGGCTATTCGCAGGTCATCAAGCTCGGGCCGCGCTTCTCGCA
CCTGACCATCTCGCTGCCCTGA